GRP78 anticorps (C-Term)

N° du produit ABIN3043851

Détail du produit anti-GRP78 anticorps

Antigène: GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))

Épitope: AA 592-624, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRP78 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ETMEKAVEEK IEWLESHQDA DIEDFKAKKK ELE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 5 (glucose-regulated protein, 78 kDa)
Protein Name: 78 kDa glucose-regulated protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-GRP78 (ABIN3043851)

Wang, Wang, Huang, Yang, Zhao, Wei, Zhao: "Erratum to: Ibutilide protects against cardiomyocytes injury via inhibiting endoplasmic reticulum and mitochondrial stress pathways." dans: Heart and vessels, Vol. 32, Issue 2, pp. 216, (2016) (PubMed).

Wu, Dong, Li: "Effects of miRNA-455 on cardiac hypertrophy induced by pressure overload." dans: International journal of molecular medicine, Vol. 35, Issue 4, pp. 893-900, (2015) (PubMed).

Li, Zhao, Xing, Sun: "Ulinastatin suppresses endoplasmic reticulum stress and apoptosis in the hippocampus of rats with acute paraquat poisoning." dans: Neural regeneration research, Vol. 10, Issue 3, pp. 467-72, (2015) (PubMed).

Ding, Zou, Li, Tian, Abdelalim, Du, She, Wang, Tan, Wang, Chen, Lv, Chang: "Study of histopathological and molecular changes of rat kidney under simulated weightlessness and resistance training protective effect." dans: PLoS ONE, Vol. 6, Issue 5, pp. e20008, (2011) (PubMed).

Détails sur GRP78

Antigène: GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))

Autre désignation: HSPA5 (HSPA5 Produits)

Synonymes: anticorps GRP78, anticorps BiP, anticorps GRP-78, anticorps grp78, anticorps hspa5a, anticorps BIP, anticorps MIF2, anticorps AL022860, anticorps AU019543, anticorps Bip, anticorps D2Wsu141e, anticorps D2Wsu17e, anticorps Grp78, anticorps Hsce70, anticorps SEZ-7, anticorps Sez7, anticorps baffled, anticorps mBiP, anticorps cb865, anticorps fb60h09, anticorps fi36d04, anticorps wu:fb60h09, anticorps wu:fi36d04, anticorps zgc:55994, anticorps zgc:77606, anticorps 78 kDa glucose-regulated protein, anticorps heat shock protein family A (Hsp70) member 5, anticorps BiP/GRP78, anticorps glucose-regulated protein 78, anticorps putative glucose-regulated protein 78, anticorps Hsp70 family ATPase KAR2, anticorps heat shock protein family A (Hsp70) member 5 S homeolog, anticorps heat shock 70 kDa protein 5a, anticorps heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa), anticorps heat shock protein 5, anticorps heat shock protein family A member 5, anticorps CpipJ_CPIJ003550, anticorps HSPA5, anticorps grp78, anticorps LOC100533358, anticorps BiP/grp78, anticorps Tc00.1047053506585.40, anticorps Tb11.02.5450, anticorps Tb11.02.5500, anticorps LMJF_28_1200, anticorps KAR2, anticorps LOC100135840, anticorps hspa5.S, anticorps hspa5, anticorps Hspa5

Sujet: HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

Synonyms: 78 kDa glucose regulated protein antibody|78 kDa glucose-regulated protein antibody| AL022860 antibody|AU019543 antibody|BIP antibody| D2Wsu141e antibody|D2Wsu17e antibody| Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78 antibody|Endoplasmic reticulum lumenal Ca2+ binding protein grp78 antibody|FLJ26106 antibody|Glucose Regulated Protein 78 kDa antibody|GRP 78 antibody|GRP-78 antibody|GRP78 antibody|GRP78_HUMAN antibody|Heat shock 70 kDa protein 5 antibody|Heat Shock 70 kDa Protein 5 antibody|Hsce70 antibody| HSPA 5 antibody|HSPA5 antibody|Immunoglobulin Heavy Chain Binding Protein antibody|Immunoglobulin heavy chain-binding protein antibody|mBiP antibody|MIF2 antibody|Sez7 antibody

ID gène: 3309

UniProt: P11021

Pathways: Thyroid Hormone Synthesis, ER-Nucleus Signaling