HSPA9 anticorps (C-Term)

N° du produit ABIN3043853

Détail du produit anti-HSPA9 anticorps

Antigène: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Épitope: AA 646-679, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA9 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 9 (mortalin)
Protein Name: Stress-70 protein, mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HSPA9

Antigène: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Autre désignation: HSPA9 (HSPA9 Produits)

Synonymes: anticorps APG-2, anticorps HS24/P52, anticorps HSPH2, anticorps RY, anticorps hsp70, anticorps hsp70RY, anticorps CSA, anticorps GRP-75, anticorps GRP75, anticorps HSPA9B, anticorps MOT, anticorps MOT2, anticorps MTHSP75, anticorps PBP74, anticorps Hspa9a, anticorps csa, anticorps grp-75, anticorps grp75, anticorps hspa9, anticorps hspa9b, anticorps mortalin, anticorps mot, anticorps mot2, anticorps pbp74, anticorps mot-2, anticorps mthsp75, anticorps 74kDa, anticorps Csa, anticorps Grp75, anticorps Hsc74, anticorps Hsp74, anticorps Hsp74a, anticorps Mortalin, anticorps Mot-2, anticorps Mot2, anticorps Mthsp70, anticorps Pbp74, anticorps cb740, anticorps crs, anticorps wu:fc14d08, anticorps wu:fc27c10, anticorps wu:fc38a06, anticorps heat shock protein family A (Hsp70) member 4, anticorps heat shock protein family A (Hsp70) member 9, anticorps heat shock protein family A member 9, anticorps heat shock protein family A (Hsp70) member 9 S homeolog, anticorps stress-70 protein, mitochondrial, anticorps heat shock protein 9, anticorps heat shock protein Hsp9, anticorps HSPA4, anticorps HSPA9, anticorps Hspa9, anticorps hspa9.S, anticorps hspa9, anticorps LOC577721, anticorps hsp9

Sujet: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

Synonyms: 75 kDa glucose regulated protein antibody|75 kDa glucose-regulated protein antibody|CSA antibody|Glucose Regulated Protein antibody| Grp 75 antibody|GRP-75 antibody|GRP75 antibody| GRP75_HUMAN antibody|Heat shock 70 kDa protein 9 antibody|Heat shock 70kD protein 9 antibody|heat shock 70 kDa protein 9 antibody|Heat shock 70 kDa protein 9B antibody|Heat shock protein 74 kDa A antibody|Heat shock protein A antibody|Heat shock protein cognate 74 antibody|Hsc74 antibody|Hsp74 antibody|Hsp74a antibody|HSPA9 antibody|Hspa9a antibody|HSPA9B antibody|MGC4500 antibody|mitochondrial antibody|Mortalin 2 antibody|Mortalin antibody|Mortalin perinuclear antibody| Mortalin2 antibody|MOT 2 antibody|MOT antibody|MOT2 antibody|Mthsp70 antibody|p66 mortalin antibody|P66 MOT antibody|PBP74 antibody| Peptide binding protein 74 antibody|Peptide-binding protein 74 antibody|Stress 70 protein mitochondrial antibody|Stress 70 protein mitochondrial precursor antibody|Stress-70 protein antibody

ID gène: 3313

UniProt: P38646