Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

IDH1 anticorps (C-Term)

IDH1 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043855
  • Antigène Voir toutes IDH1 Anticorps
    IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
    Épitope
    • 16
    • 15
    • 9
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 381-413, C-Term
    Reactivité
    • 95
    • 57
    • 35
    • 7
    • 7
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 77
    • 38
    • 3
    • 1
    Lapin
    Clonalité
    • 77
    • 42
    Polyclonal
    Conjugué
    • 67
    • 11
    • 10
    • 5
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp IDH1 est non-conjugé
    Application
    • 87
    • 37
    • 36
    • 31
    • 22
    • 17
    • 15
    • 13
    • 9
    • 7
    • 5
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
    Séquence
    KGLPNVQRSD YLNTFEFMDK LGENLKIKLA QAK
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
    Gene Name: isocitrate dehydrogenase 1 (NADP+), soluble
    Protein Name: Isocitrate dehydrogenase [NADP] cytoplasmic
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
    Isotype
    IgG
    Top Product
    Discover our top product IDH1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Li, Zhao, Qi, Wang, Zhang, Li, Qin: "lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." dans: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).

  • Antigène
    IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
    Autre désignation
    IDH1 (IDH1 Produits)
    Synonymes
    anticorps IDCD, anticorps IDH, anticorps IDP, anticorps IDPC, anticorps PICD, anticorps NADP-CICDH, anticorps AI314845, anticorps AI788952, anticorps E030024J03Rik, anticorps Id-1, anticorps Idh-1, anticorps Idpc, anticorps cb876, anticorps fm90e09, anticorps im:7143416, anticorps wu:fm90e09, anticorps F23E12.180, anticorps F23E12_180, anticorps IDH-I, anticorps NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1, anticorps isocitrate dehydrogenase 1, anticorps isocitrate dehydrogenase I, anticorps isocitrate dehydrogenase (NADP(+)) 1, cytosolic, anticorps isocitrate dehydrogenase 1 (NADP+), soluble, anticorps isocitrate dehydrogenase 1 (NADP+) L homeolog, anticorps isocitrate dehydrogenase 1, anticorps IDH1, anticorps Idh1, anticorps idh1.L, anticorps idh1
    Sujet
    Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

    Synonyms: Cytosolic NADP isocitrate dehydrogenase antibody|Cytosolic NADP-isocitrate dehydrogenase antibody|Epididymis luminal protein 216 antibody|Epididymis secretory protein Li 26 antibody|HEL-216 antibody|HEL-S-26 antibody|ICDH antibody|IDCD antibody|IDH antibody|IDH1 antibody|IDHC_HUMAN antibody|IDP antibody|IDPC antibody|Isocitrate dehydrogenase [NADP] cytoplasmic antibody|Isocitrate dehydrogenase 1 (NADP+) soluble antibody|NADP dependent isocitrate dehydrogenase cytosolic antibody|NADP dependent isocitrate dehydrogenase peroxisomal antibody|NADP(+)-specific ICDH antibody|Oxalosuccinate decarboxylase antibody|PICD antibody
    ID gène
    3417
    UniProt
    O75874
    Pathways
    L'effet Warburg
Vous êtes ici:
Support technique