KCNA2 anticorps (C-Term)

N° du produit ABIN3043865

Détail du produit anti-KCNA2 anticorps

Antigène: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Épitope: AA 466-499, C-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNA2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 2(KCNA2) detection. Tested with WB in Human,Mouse,Rat.

Séquence: NNSNEDFREE NLKTANCTLA NTNYVNITKM LTDV

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 2(KCNA2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: potassium channel, voltage gated shaker related subfamily A, member 2
Protein Name: Potassium voltage-gated channel subfamily A member 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur KCNA2

Antigène: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Autre désignation: KCNA2 (KCNA2 Produits)

Synonymes: anticorps KCNA2, anticorps kcna2, anticorps HBK5, anticorps HK4, anticorps HUKIV, anticorps KV1.2, anticorps MK2, anticorps NGK1, anticorps RBK2, anticorps Akr6a4, anticorps ENSMUSG00000074335, anticorps Gm10672, anticorps Kca1-2, anticorps Kv1.2, anticorps Mk-2, anticorps BK2, anticorps XSha2, anticorps k(v)1.2, anticorps kcna2-a, anticorps kv1.2, anticorps potassium voltage-gated channel subfamily A member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 1, anticorps potassium voltage-gated channel, shaker-related subfamily, member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog, anticorps KCNA2, anticorps kcna1, anticorps Kcna2, anticorps LOC100537815, anticorps kcna2.S

Sujet: Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.

Synonyms: Akr6a4 antibody|BK2 antibody|HBK5 antibody|HK4 antibody|HUKIV antibody|Kca1 2 antibody|kcna2 antibody|KV1.2 antibody|MGC50217 antibody|Mk 2 antibody|MK2 antibody|NGK1 antibody|Potassium voltage gated channel shaker related subfamily member 2 antibody|Potassium voltage-gated channel subfamily A member 2 antibody|RBK2 antibody|Voltage gated potassium channel subunit Kv1.2 antibody

ID gène: 3737

UniProt: P16389