NPY anticorps (Middle Region)

N° du produit ABIN3043892

Détail du produit anti-NPY anticorps

Antigène: NPY (Neuropeptide Y (NPY))

Épitope: AA 29-64, Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPY est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: YPSKPDNPGE DAPAEDMARY YSALRHYINL ITRQRY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: neuropeptide Y
Protein Name: Pro-neuropeptide Y

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Neuropeptide Y is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-NPY (ABIN3043892)

Fan, Mu, Qin, Bi, Pei: "Different effects of implanting sensory nerve or blood vessel on the vascularization, neurotization, and osteogenesis of tissue-engineered bone in vivo." dans: BioMed research international, Vol. 2014, pp. 412570, (2015) (PubMed).

Song, Yang, Zhong, Chen: "Sericin protects against diabetes-induced injuries in sciatic nerve and related nerve cells." dans: Neural regeneration research, Vol. 8, Issue 6, pp. 506-13, (2014) (PubMed).

Wang, Zhou, Zhang, Wu, Zhang, Zhang: "Identification and localization of gastrointestinal hormones in the skin of the bullfrog Rana catesbeiana during periods of activity and hibernation." dans: Acta histochemica, Vol. 116, Issue 8, pp. 1418-26, (2014) (PubMed).

Huang, Zhu, Zhang, Zhu, Liu, Zhu, Wang, Li, Yang, Dong, Liu, Chen, Zhang, Yang, Deng, Fan, Wang, Liu, Ma, Fu, Wu: "S100+ cells: a new neuro-immune cross-talkers in lymph organs." dans: Scientific reports, Vol. 3, pp. 1114, (2013) (PubMed).

Wang, Chen, Yue, Bai, Kou, Jin: "Xiaoyaosan decoction regulates changes in neuropeptide y and leptin receptor in the rat arcuate nucleus after chronic immobilization stress." dans: Evidence-based complementary and alternative medicine : eCAM, Vol. 2012, pp. 381278, (2012) (PubMed).

Détails sur NPY

Antigène: NPY (Neuropeptide Y (NPY))

Autre désignation: NPY (NPY Produits)

Sujet: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.

Synonyms: C-flanking peptide of NPY antibody|CPON antibody|Neuropeptide tyrosine antibody|Neuropeptide Y precursor antibody|NPY antibody|NPY_HUMAN antibody|Pro neuropeptide Y antibody|PYY 4 antibody|PYY4 antibody|Y Neuropeptide antibody

ID gène: 4852

UniProt: P01303

Pathways: Feeding Behaviour