PDGFRA anticorps (C-Term)

N° du produit ABIN3043897

Détail du produit anti-PDGFRA anticorps

Antigène: PDGFRA (Platelet Derived Growth Factor Receptor alpha (PDGFRA))

Épitope: AA 968-1002, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDGFRA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha(PDGFRA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DFLKSDHPAV ARMRVDSDNA YIGVTYKNEE DKLKD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Platelet-derived growth factor receptor alpha(PDGFRA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: platelet-derived growth factor receptor, alpha polypeptide
Protein Name: Platelet-derived growth factor receptor alpha

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PDGFRA (968-1002aa DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-PDGFRA (ABIN3043897)

Zeng, Zhao, Ouyang, Zhao, Zhang, Chen, Yu, Lei: "Label-retaining assay enriches tumor-initiating cells in glioblastoma spheres cultivated in serum-free medium." dans: Oncology letters, Vol. 12, Issue 2, pp. 815-824, (2016) (PubMed).

Détails sur PDGFRA

Antigène: PDGFRA (Platelet Derived Growth Factor Receptor alpha (PDGFRA))

Autre désignation: PDGFRA (PDGFRA Produits)

Synonymes: anticorps AI115593, anticorps CD140a, anticorps Pdgfr-2, anticorps APDGFR, anticorps PDGFACE, anticorps CD140A, anticorps PDGFR-2, anticorps PDGFR2, anticorps RHEPDGFRA, anticorps PDGFR, anticorps PDGFR-A, anticorps platelet derived growth factor receptor alpha, anticorps platelet derived growth factor receptor, alpha polypeptide, anticorps platelet-derived growth factor receptor, alpha polypeptide L homeolog, anticorps platelet-derived growth factor receptor, alpha polypeptide, anticorps PDGFRA, anticorps Pdgfra, anticorps pdgfra.L

Sujet: PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.

Synonyms: Alpha platelet derived growth factor receptor antibody|Alpha-type platelet-derived growth factor receptor antibody|CD 140a antibody| CD140 antigen-like family member A antibody| CD140a antibody|CD140a antigen antibody|MGC74795 antibody|PDGF alpha chain antibody|PDGF R alpha antibody|PDGF-R-alpha antibody|PDGFR 2 antibody|PDGFR A antibody|PDGFR alpha antibody|PDGFR2 antibody|PDGFRA antibody| PDGFRA/BCR fusion antibody|PGFRA_HUMAN antibody|Platelet derived growth factor receptor 2 antibody|Platelet derived growth factor receptor alpha antibody|Platelet derived growth factor receptor alpha polypeptide antibody|Platelet derived growth factor receptor antibody|Rearranged in hypereosinophilia platelet derived growth factor receptor alpha fusion protein antibody|RHEPDGFRA antibody

ID gène: 5156

UniProt: P16234

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Platelet-derived growth Factor Receptor Signaling