UBA1 anticorps (N-Term)

N° du produit ABIN3044558

Détail du produit anti-UBA1 anticorps

Antigène: UBA1 (Ubiquitin-Like Modifier Activating Enzyme 1 (UBA1))

Épitope: AA 102-139, N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBA1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Ubiquitin-like modifier-activating enzyme 1(UBA1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: HDQGTAQWAD LSSQFYLREE DIGKNRAEVS QPRLAELN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ubiquitin-like modifier-activating enzyme 1(UBA1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ubiquitin like modifier activating enzyme 1
Protein Name: Ubiquitin-like modifier-activating enzyme 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1 (102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur UBA1

Antigène: UBA1 (Ubiquitin-Like Modifier Activating Enzyme 1 (UBA1))

Autre désignation: UBA1 (UBA1 Produits)

Synonymes: anticorps A1S9, anticorps A1S9T, anticorps A1ST, anticorps AMCX1, anticorps GXP1, anticorps POC20, anticorps SMAX2, anticorps UBA1A, anticorps UBE1, anticorps UBE1X, anticorps DDBDRAFT_0190927, anticorps DDBDRAFT_0220497, anticorps DDB_0190927, anticorps DDB_0220497, anticorps Sbx, anticorps Ube-1, anticorps Ube1x, anticorps a1s9, anticorps a1s9t, anticorps a1st, anticorps amcx1, anticorps gxp1, anticorps poc20, anticorps smax2, anticorps uba1a, anticorps ube1, anticorps ube1x, anticorps uba1, anticorps uba1b, anticorps ube, anticorps zgc:66143, anticorps wu:fa01e08, anticorps wu:fb30f01, anticorps wu:fi21c11, anticorps wu:fj14g11, anticorps ubiquitin like modifier activating enzyme 1, anticorps ubiquitin activating enzyme E1, anticorps Ubiquitin-conjugating enzyme E1, anticorps ubiquitin-like modifier activating enzyme 1, anticorps ubiquitin-like modifier activating enzyme 1 S homeolog, anticorps ubiquitin-like modifier activating enzyme 1 L homeolog, anticorps UBA1, anticorps uae1, anticorps GL50803_4083, anticorps GL50803_10661, anticorps Uba1, anticorps uba1.S, anticorps uba1.L, anticorps uba1, anticorps ptr3

Sujet: Ubiquitin-like modifier activating enzyme 1 (UBA1) is an enzyme which in humans is encoded by the UBA1 gene. The protein encoded by this gene catalyzes the first step in ubiquitin conjugation, or ubiquitination, to mark cellular proteins for degradation. Specifically, UBA1 catalyzes the ATP-dependent adenylation of ubiquitin (Ub), thereby forming a thioester bond between the two. It also continues to participate in subsequent steps of ubiquination as a Ub carrier. UBA1 is one of only two human ubiquitin-activating enzymes (E1), the other being UBA6, and thus is largely responsible for protein ubiquitination in humans. Through its central role in ubiquitination, UBA1 has been linked to cell cycle regulation, endocytosis, signal transduction, apoptosis, DNA damage repair, and transcriptional regulation. Additionally, UBE1 helps regulate the NEDD8 pathway, thus implicating it in protein folding, as well as mitigating the depletion of ubiquitin levels during stress.

Synonyms: A1S9 antibody|A1S9 protein antibody|A1S9T and BN75 temperature sensitivity complementing antibody|A1S9T antibody|A1ST antibody|AMCX1 antibody|CFAP124 antibody|CTD-2522E6.1 antibody|GXP 1 antibody|GXP1 antibody|MGC4781 antibody|POC20 antibody|POC20 centriolar protein homolog antibody|Protein A1S9 antibody|SMAX2 antibody|Uba1 antibody|UBA1, ubiquitin-activating enzyme E1 homolog A antibody|UBA1_HUMAN antibody|UBA1A antibody|UBE 1 antibody|UBE 1X antibody|UBE1 antibody|UBE1X antibody|Ubiquitin activating enzyme E1 antibody| Ubiquitin-activating enzyme E1 antibody|Ubiquitin-like modifier-activating enzyme 1 antibody

ID gène: 7317

UniProt: P22314