DVL1 anticorps (Dishevelled, Dsh Homolog 1 (Drosophila))

Details for Product anti-DVL1 Antibody No. ABIN4268104, Fournisseur: Connectez-vous pour afficher
  • DVL
  • DVL1L1
  • DVL1P1
  • Dvl
  • mKIAA4029
  • dvl-1
  • DSH
  • DVL-1
  • dvl1
  • dvl2l
  • Xdsh
  • dsh1
  • dishevelled segment polarity protein 1
  • dishevelled, dsh homolog 1 (Drosophila)
  • microRNA 6808
  • dishevelled segment polarity protein 1b
  • dishevelled segment polarity protein 1 L homeolog
  • DVL1
  • Dvl1
  • MIR6808
  • dvl1b
  • dvl1.L
Cet anticorp DVL1 est non-conjugé
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène Synthetic peptides corresponding to DVL1(dishevelled, dsh homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DVL1. Peptide sequence LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK.
Purification Protein A purified
Plasmids, Primers & others Plasmids, Primers & others DVL1 products on genomics-online (e.g. as negative or positive controls)
Autre désignation Dishevelled-1 (DVL1 Antibody Extrait)
Sujet Gene Symbol: DVL1
ID gène 1855
Pathways Signalisation WNT, Synaptic Membrane, Skeletal Muscle Fiber Development
Indications d'application Western Blot 1:100-1:2000, Immunohistochemistry-ParaffinA band is observed at ~38 kDa by Western Blot. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25975243)

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.
Images (Fournisseur)
Western Blotting (WB) image for anti-Dishevelled, Dsh Homolog 1 (Drosophila) (DVL1) antibody (ABIN4268104) Western Blot: Dishevelled-1 Antibody [NBP1-58317] - HepG2 cell lysate, concentration ...
Produit citée dans: Jung, Lee, Kim, Dhong, Cho, Roh: "Role of Wnt signaling pathway in progression of sinonasal inverted papilloma to squamous cell carcinoma." dans: American journal of rhinology & allergy, Vol. 29, Issue 3, pp. e81-6, 2015 (PubMed). (Échantillon (espèces): Human). Détails: Immunohistochemistry (Paraffin-embedded Sections)

Avez-vous cherché autre chose?