CYP20A1 anticorps (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1)

Details for Product anti-CYP20A1 Antibody No. ABIN4301724, Fournisseur: Connectez-vous pour afficher
  • CYP-M
  • A930011N14Rik
  • Cypm
  • wu:fa10c06
  • zgc:63986
  • cyp-m
  • cytochrome P450 family 20 subfamily A member 1
  • cytochrome P450, family 20, subfamily a, polypeptide 1
  • cytochrome P450, family 20, subfamily A, polypeptide 1
  • cytochrome P450 family 20 subfamily A member 1 L homeolog
  • CYP20A1
  • Cyp20a1
  • cyp20a1
  • cyp20a1.L
Cet anticorp CYP20A1 est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others CYP20A1 products on genomics-online (e.g. as negative or positive controls)
Autre désignation CYP20A1 (CYP20A1 Antibody Extrait)
Sujet Gene Symbol: CYP20A1
ID gène 57404
UniProt Q6UW02
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1) antibody (ABIN4301724) Immunohistochemistry: CYP20A1 Antibody [NBP2-31614] - pancreas
Immunohistochemistry (IHC) image for anti-Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1) antibody (ABIN4301724) Immunohistochemistry: CYP20A1 Antibody [NBP2-31614] - Immunohistochemical staining of...
Immunohistochemistry (IHC) image for anti-Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1) antibody (ABIN4301724) Immunohistochemistry: CYP20A1 Antibody [NBP2-31614] - liver cancer
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1) antibody (ABIN4301724) Immunohistochemistry-Paraffin: CYP20A1 Antibody - Staining of human testis shows str...
Immunofluorescence (IF) image for anti-Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1) antibody (ABIN4301724) Immunocytochemistry/Immunofluorescence: CYP20A1 Antibody - Staining of human cell li...
Avez-vous cherché autre chose?