Homeobox B7 (HOXB7) anticorps

Détails pour le produit réf. ABIN4319716
Antigène
  • HOXB7
  • 3.4
  • ANT-C
  • ANT-P
  • ANTC
  • ANTP
  • Ant
  • AntP
  • AntP1
  • Antp P1
  • Antp P2
  • Antp1
  • Aus
  • BG:DS07700.1
  • CG1028
  • DMANTPE1
  • DRO15DC96Z
  • DmAntp
  • Dmel\\CG1028
  • Hu
  • Ns
  • Scx
  • antp
  • l(3)84Ba
  • Hox2r1b
  • R1b
  • fc39g02
  • hoxb7
  • wu:fc39g02
  • z-139
  • HHO.C1
  • HOX2
  • HOX2C
  • Hox-2.3
  • AI325018
  • Hbox2
  • hho.c1
  • hox-2.3
  • hox2
  • hox2c
  • homeobox B7
  • Antennapedia
  • homeo box B7
  • homeobox B7a
  • homeobox B7 L homeolog
  • HOXB7
  • Antp
  • Hoxb7
  • hoxb7a
  • hoxb7.L
Reactivité
Humain
81
50
32
12
11
9
7
5
3
3
2
2
1
1
1
1
1
Hôte
Lapin
94
18
Clonalité
Polyclonal
Conjugué
Inconjugué
7
6
6
6
6
6
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
102
63
24
11
10
2
2
1
1
1
Options
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigène
Autre désignation HOXB7 (HOXB7 Antibody Extrait)
Sujet Gene Symbol: HOXB7
ID gène 3217
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Homeobox B7 (HOXB7) antibody (ABIN4319716) Immunocytochemistry/Immunofluorescence: HOXB7 Antibody [NBP2-14098] Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Homeobox B7 (HOXB7) antibody (ABIN4319716) Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human urinar...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Homeobox B7 (HOXB7) antibody (ABIN4319716) Immunohistochemistry-Paraffin: HOXB7 Antibody - Staining of human colorectal cancer ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Homeobox B7 (HOXB7) antibody (ABIN4319716) Immunohistochemistry-Paraffin: HOXB7 Antibody - Staining of human Fallopian tube sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Homeobox B7 (HOXB7) antibody (ABIN4319716) Immunohistochemistry-Paraffin: HOXB7 Antibody - Staining of human placenta shows mod...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Homeobox B7 (HOXB7) antibody (ABIN4319716) Immunohistochemistry-Paraffin: HOXB7 Antibody - Staining of human rectum shows moder...
Produit citée dans: Chen, Mo, Brosseau, Shipman, Wang, Liao, Cooper, Allaway, Gosline, Guinney, Carroll, Le: "Spatiotemporal Loss of NF1 in Schwann Cell Lineage Leads to Different Types of Cutaneous Neurofibroma Susceptible to Modification by the Hippo Pathway." dans: Cancer discovery, Vol. 9, Issue 1, pp. 114-129, 2019 (PubMed). Méthode utilisée: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (Échantillon (espèces): Mouse (Murine)).

Wang, Bledsoe, Graham, Asmann, Viswanatha, Lewis, Lewis, Chou, Yaszemski, Jen, Westendorf, Oliveira: "Recurrent PAX3-MAML3 fusion in biphenotypic sinonasal sarcoma." dans: Nature genetics, Vol. 46, Issue 7, pp. 666-8, 2014 (PubMed).