ICK anticorps (Intestinal Cell (MAK-Like) Kinase)

Details for Product anti-ICK Antibody No. ABIN4320963, Fournisseur: Connectez-vous pour afficher
Antigène
  • ICK
  • ECO
  • LCK2
  • MRK
  • 2210420N10Rik
  • AI848300
  • Mrk
  • intestinal cell kinase
  • intestinal cell (MAK-like) kinase
  • ICK
  • ick
  • Ick
Reactivité
Humain
85
64
62
6
3
2
2
2
2
1
1
1
Hôte
Lapin
88
1
Clonalité
Polyclonal
Conjugué
Cet anticorp ICK est non-conjugé
3
3
3
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
53
35
26
19
10
8
5
4
3
2
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRR
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others ICK products on genomics-online (e.g. as negative or positive controls)
Autre désignation ICK (ICK Antibody Extrait)
Sujet Gene Symbol: ICK
ID gène 22858
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Intestinal Cell (MAK-Like) Kinase (ICK) antibody (ABIN4320963) Immunocytochemistry/Immunofluorescence: ICK Antibody [NBP1-81459] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Intestinal Cell (MAK-Like) Kinase (ICK) antibody (ABIN4320963) Immunohistochemistry-Paraffin: ICK Antibody [NBP1-81459] - Staining of human colon sh...
Produit citée dans: Häggarth, Hägglöf, Jaraj, Wester, Pontén, Ostman, Egevad: "Diagnostic biomarkers of prostate cancer." dans: Scandinavian journal of urology and nephrology, Vol. 45, Issue 1, pp. 60-7, 2011 (PubMed).

Avez-vous cherché autre chose?