IMPDH2 anticorps (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2)

Details for Product anti-IMPDH2 Antibody No. ABIN4325727
Antigène
  • imp2
  • impd2
  • impdh-ii
  • impdh2
  • IMPD2
  • IMPDH-II
  • IMPD 2
  • IMPDH 2
  • cb635
  • wu:fb64g02
  • wu:fc43f09
  • IMPD
  • inosine monophosphate dehydrogenase 2
  • IMP (inosine 5'-monophosphate) dehydrogenase 2
  • inosine 5'-phosphate dehydrogenase 2
  • IMPDH2
  • impdh2.S
  • impdh2
  • Impdh2
Reactivité
Humain
116
44
38
4
4
4
4
3
3
2
2
2
2
1
1
Hôte
Lapin
91
17
8
Clonalité
Polyclonal
Conjugué
Cet anticorp IMPDH2 est non-conjugé
9
6
6
3
3
3
3
3
3
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
83
49
33
14
10
8
8
7
4
3
2
2
1
1
Options
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others IMPDH2 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation IMP Dehydrogenase 2/IMPDH2 (IMPDH2 Antibody Extrait)
Sujet Gene Symbol: IMPDH2
Poids moléculaire Theoretical MW: 56 kDa
ID gène 3615
UniProt P12268
Pathways Ribonucleoside Biosynthetic Process
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500Immunohistochemistry retrieval recommended: HIER pH 6 The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) antibody (ABIN4325727) Immunohistochemistry-Paraffin: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Sta...
Western Blotting (WB) image for anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) antibody (ABIN4325727) Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Lane 1: Marker [kDa]...
Western Blotting (WB) image for anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) antibody (ABIN4325727) Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody - Analysis in human cell line U-25...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) antibody (ABIN4325727) Immunohistochemistry-Paraffin: IMP Dehydrogenase 2/IMPDH2 Antibody - Staining of hum...
Immunofluorescence (IF) image for anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) antibody (ABIN4325727) Immunocytochemistry/Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody - Staini...
Western Blotting (WB) image for anti-IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2) antibody (ABIN4325727) Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody - Analysis in U-251MG cells transf...
Produit citée dans: Barfeld, Fazli, Persson, Marjavaara, Urbanucci, Kaukoniemi, Rennie, Ceder, Chabes, Visakorpi, Mills: "Myc-dependent purine biosynthesis affects nucleolar stress and therapy response in prostate cancer." dans: Oncotarget, Vol. 6, Issue 14, pp. 12587-602, 2015 (PubMed). (Échantillon (espèces): Human). Détails: Western Blotting

Wawrzyniak, Bianchi-Smiraglia, Bshara, Mannava, Ackroyd, Bagati, Omilian, Im, Fedtsova, Miecznikowski, Moparthy, Zucker, Zhu, Kozlova, Berman, Hoek, Gudkov, Shewach, Morrison, Nikiforov: "A purine nucleotide biosynthesis enzyme guanosine monophosphate reductase is a suppressor of melanoma invasion." dans: Cell reports, Vol. 5, Issue 2, pp. 493-507, 2013 (PubMed). (Échantillon (espèces): Human). Détails: Immunohistochemistry

Floryk, Thompson: "Antiproliferative effects of AVN944, a novel inosine 5-monophosphate dehydrogenase inhibitor, in prostate cancer cells." dans: International journal of cancer, Vol. 123, Issue 10, pp. 2294-302, 2008 (PubMed).

Mannava, Grachtchouk, Wheeler, Im, Zhuang, Slavina, Mathews, Shewach, Nikiforov: "Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells." dans: Cell cycle (Georgetown, Tex.), Vol. 7, Issue 15, pp. 2392-400, 2008 (PubMed).

Avez-vous cherché autre chose?