Mitogen-Activated Protein Kinase Kinase Kinase 6 (MAP3K6) anticorps

Détails pour le produit réf. ABIN4332653, Fournisseur: Connectez-vous pour afficher
  • ASK2
  • MEKK6
  • Ask2
  • mitogen-activated protein kinase kinase kinase 6
  • MAP3K6
  • Map3k6
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: EEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGA RLGRNHVEELLRCLGAHIHTPNRR
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Autre désignation MAP3K6 (MAP3K6 Antibody Extrait)
Sujet Gene Symbol: MAP3K6
ID gène 9064
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase 6 (MAP3K6) antibody (ABIN4332653) Immunohistochemistry-Paraffin: MAP3K6 Antibody [NBP2-14219] Staining of human smooth ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase 6 (MAP3K6) antibody (ABIN4332653) Immunohistochemistry-Paraffin: MAP3K6 Antibody - Staining of human smooth muscle sho...
Immunofluorescence (IF) image for anti-Mitogen-Activated Protein Kinase Kinase Kinase 6 (MAP3K6) antibody (ABIN4332653) Immunocytochemistry/Immunofluorescence: MAP3K6 Antibody - Immunofluorescent staining...
Avez-vous cherché autre chose?