Mitogen-Activated Protein Kinase Kinase Kinase 6 (MAP3K6) anticorps

Détails pour le produit réf. ABIN4332653
Antigène
  • ASK2
  • MAPKKK6
  • MEKK6
  • Ask2
  • mitogen-activated protein kinase kinase kinase 6
  • MAP3K6
  • Map3k6
Reactivité
Humain
62
35
5
Hôte
Lapin
57
7
3
Clonalité
Polyclonal
Conjugué
Inconjugué
7
6
6
5
5
5
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
49
48
44
7
3
2
2
2
1
Options
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: EEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGA RLGRNHVEELLRCLGAHIHTPNRR
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Antigène
Autre désignation MAP3K6 (MAP3K6 Antibody Extrait)
Sujet Gene Symbol: MAP3K6
ID gène 9064
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Image no. 1 for anti-Mitogen-Activated Protein Kinase Kinase Kinase 6 (MAP3K6) antibody (ABIN4332653) Immunohistochemistry-Paraffin: MAP3K6 Antibody [NBP2-14219] Staining of human smooth ...
Avez-vous cherché autre chose?