Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 3 (NUDT3) anticorps

Détails pour le produit réf. ABIN4341123, Fournisseur: Connectez-vous pour afficher
Antigène
  • DIPP
  • DIPP-1
  • DIPP1
  • 1110011B09Rik
  • AA960325
  • Dipp
  • NUDT3
  • zgc:55746
  • nudix hydrolase 3
  • nudix (nucleotide diphosphate linked moiety X)-type motif 3
  • nudix (nucleoside diphosphate linked moiety X)-type motif 3a
  • NUDT3
  • Nudt3
  • nudt3a
Reactivité
Humain
10
4
2
2
2
1
1
1
1
1
Hôte
Lapin
6
4
Clonalité
Polyclonal
Application
Immunohistochemistry (IHC)
10
5
2
2
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids:LRQGYSANNGTPVVATTYSVSAQSSMSGIR
Isotype IgG
Purification Immunogen affinity purified
Antigène
Autre désignation NUDT3 (NUDT3 Antibody Extrait)
Sujet Gene Symbol: NUDT3
ID gène 11165
Indications d'application Immunohistochemistry 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 3 (NUDT3) antibody (ABIN4341123) Immunohistochemistry: NUDT3 Antibody [NBP2-49205] - Staining of human vagina shows st...
Avez-vous cherché autre chose?