Occludin anticorps (OCLN)

Details for Product anti-OCLN Antibody No. ABIN4341293
Antigène
  • AI503564
  • Ocl
  • ocln
  • oclnb
  • tpmt
  • OCLN
  • wu:fd23h10
  • wu:fi13c01
  • zgc:113992
  • zgc:56359
  • BLCPMG
  • occludin
  • occludin S homeolog
  • occludin a
  • Ocln
  • OCLN
  • ocln.S
  • ocln
  • oclna
Reactivité
Humain, Souris
152
90
81
18
15
4
4
4
3
2
2
2
Hôte
Lapin
133
25
3
Clonalité
Polyclonal
Conjugué
Cet anticorp Occludin est non-conjugé
11
6
6
6
5
5
5
5
5
2
2
2
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
113
60
44
24
14
14
13
8
4
2
2
1
1
1
Options
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others Occludin products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation Occludin (OCLN Antibody Extrait)
Sujet Gene Symbol: OCLN
ID gène 100506658
Pathways Cell-Cell Junction Organization, Hepatitis C
Indications d'application Western Blot 1:250 - 1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human kid...
Western Blotting (WB) image for anti-Occludin (OCLN) antibody (ABIN4341293) Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: Marker [kDa] 220, 112, 84, 47,...
Immunofluorescence (IF) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP1-87402] - Methanol fix...
Immunofluorescence (IF) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of ...
Western Blotting (WB) image for anti-Occludin (OCLN) antibody (ABIN4341293) Western Blot: Occludin Antibody - Lane 1: untreated vascular endothelial cells Lane ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody - Staining of human skeletal muscle...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody - Staining in human thyroid gland a...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody - Staining of human thyroid gland s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody - Staining in human thyroid gland a...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody - Staining of human breast cancer s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody - Staining of human prostate cancer...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Occludin (OCLN) antibody (ABIN4341293) Immunohistochemistry-Paraffin: Occludin Antibody - Staining of human stomach shows m...
Produit citée dans: Almássy, Diszházi, Skaliczki, Márton, Magyar, Nánási, Yule: "Expression of BK channels and Na+-K+ pumps in the apical membrane of lacrimal acinar cells suggests a new molecular mechanism for primary tear-secretion." dans: The ocular surface, 2019 (PubMed). Méthode utilisée: Immunofluorescence (fixed cells) (IF/ICC) (Échantillon (espèces): Mouse (Murine)).

Rom, Zuluaga-Ramirez, Gajghate, Seliga, Winfield, Heldt, Kolpakov, Bashkirova, Sabri, Persidsky: "Hyperglycemia-Driven Neuroinflammation Compromises BBB Leading to Memory Loss in Both Diabetes Mellitus (DM) Type 1 and Type 2 Mouse Models." dans: Molecular neurobiology, Vol. 56, Issue 3, pp. 1883-1896, 2019 (PubMed). Méthode utilisée: Immunohistochemistry (IHC)

Li, Sun, Du, Wang, Fang, Yu, Xiong, Chen, Lu, Liu: "Clostridium butyricum exerts a neuroprotective effect in a mouse model of traumatic brain injury via the gut-brain axis." dans: Neurogastroenterology and motility : the official journal of the European Gastrointestinal Motility Society, Vol. 30, Issue 5, pp. e13260, 2018 (PubMed).

Messal, Fernandez, Dayot, Gratio, Nicole, Prochasson, Chantret, LeGuilloux, Jarry, Couvelard, Tréton, Voisin, Ogier-Denis, Couvineau: "Ectopic expression of OX1R in ulcerative colitis mediates anti-inflammatory effect of orexin-A." dans: Biochimica et biophysica acta. Molecular basis of disease, Vol. 1864, Issue 11, pp. 3618-3628, 2018 (PubMed). Méthode utilisée: Western Blotting (WB) (Échantillon (espèces): Mouse (Murine)).

Mikuła-Pietrasik, Uruski, Szubert, Szpurek, Sajdak, Tykarski, Książek: "Malignant ascites determine the transmesothelial invasion of ovarian cancer cells." dans: The international journal of biochemistry & cell biology, Vol. 92, pp. 6-13, 2017 (PubMed). Méthode utilisée: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (Échantillon (espèces): Human).

Liu, Schrott-Fischer, Glueckert, Benav, Rask-Andersen: "The Human "Cochlear Battery" - Claudin-11 Barrier and Ion Transport Proteins in the Lateral Wall of the Cochlea." dans: Frontiers in molecular neuroscience, Vol. 10, pp. 239, 1970 (PubMed). Méthode utilisée: Immunofluorescence (fixed cells) (IF/ICC) (Échantillon (espèces): Human).

Avez-vous cherché autre chose?