P2RY8 anticorps (Purinergic Receptor P2Y, G-Protein Coupled, 8)

Details for Product anti-P2RY8 Antibody No. ABIN4342676, Fournisseur: Connectez-vous pour afficher
Antigène
  • P2Y8
  • P2Y purinoceptor 8
  • P2Y receptor family member 8
  • purinergic receptor P2Y8
  • p2ry8
  • P2RY8
Reactivité
Humain
61
2
Hôte
Lapin
53
8
Clonalité
Polyclonal
Conjugué
Cet anticorp P2RY8 est non-conjugé
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
26
24
21
13
12
7
6
4
2
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others P2RY8 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation P2Y8 (P2RY8 Antibody Extrait)
Sujet Gene Symbol: P2RY8
ID gène 286530
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Purinergic Receptor P2Y, G-Protein Coupled, 8 (P2RY8) antibody (ABIN4342676) Immunohistochemistry: P2Y8 Antibody [NBP1-87375] - Immunohistochemical staining of hu...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Purinergic Receptor P2Y, G-Protein Coupled, 8 (P2RY8) antibody (ABIN4342676) Immunohistochemistry-Paraffin: P2Y8 Antibody - Staining of human lymph node shows mo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Purinergic Receptor P2Y, G-Protein Coupled, 8 (P2RY8) antibody (ABIN4342676) Immunohistochemistry-Paraffin: P2Y8 Antibody - Staining of human cerebral cortex sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Purinergic Receptor P2Y, G-Protein Coupled, 8 (P2RY8) antibody (ABIN4342676) Immunohistochemistry-Paraffin: P2Y8 Antibody - Staining in human lymph node and cere...
Avez-vous cherché autre chose?