Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20) anticorps

Détails pour le produit réf. ABIN4354141, Fournisseur: Connectez-vous pour afficher
  • 5848
  • BG:DS02740.15
  • CACT
  • CG5848
  • Cact
  • Dmel\\CG5848
  • cac
  • dip6
  • fs(2)ltoRN48
  • n(2)k17003
  • cact
  • dif-1
  • SLC25A20
  • DKFZp468F1219
  • zgc:77760
  • CAC
  • 1110007P09Rik
  • C78826
  • mCAC
  • cactus
  • solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
  • solute carrier family 25 member 20
  • solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 L homeolog
  • solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20
  • cact
  • slc25a20
  • SLC25A20
  • Slc25a20
  • slc25a20.L
Humain, Souris
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR
Isotype IgG
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Autre désignation SLC25A20 (SLC25A20 Antibody Extrait)
Sujet Gene Symbol: SLC25A20
ID gène 788
Pathways TCR Signaling, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location, Toll-Like Receptors Cascades
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20) antibody (ABIN4354141) Immunohistochemistry-Paraffin: SLC25A20 Antibody [NBP1-86690] - Staining of human sma...
Western Blotting (WB) image for anti-Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20) antibody (ABIN4354141) Western Blot: SLC25A20 Antibody [NBP1-86690] - Lane 1: Marker [kDa] 250, 130, 95, 72,...
Western Blotting (WB) image for anti-Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20) antibody (ABIN4354141) Western Blot: SLC25A20 Antibody [NBP1-86690] - analysis of SLC25A20 in murine ear mes...
Produit citée dans: Tachibana, Takeuchi, Inada, Yamasaki, Ishimoto, Tanaka, Hamakubo, Sakai, Kodama, Doi: "Regulation of the human SLC25A20 expression by peroxisome proliferator-activated receptor alpha in human hepatoblastoma cells." dans: Biochemical and biophysical research communications, Vol. 389, Issue 3, pp. 501-5, 2009 (PubMed).

Avez-vous cherché autre chose?