ACVR2B anticorps (C-Term)

N° du produit ABIN4886423

Détail du produit anti-ACVR2B anticorps

Antigène: ACVR2B (Activin A Receptor, Type IIB (ACVR2B))

Épitope: AA 431-466, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACVR2B est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Activin receptor type-2B(ACVR2B) detection. Tested with WB in Human,Rat.

Séquence: VVHKKMRPTI KDHWLKHPGL AQLCVTIEEC WDHDAE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Activin receptor type-2B(ACVR2B) detection. Tested with WB in Human,Rat.
Gene Name: activin A receptor type 2B
Protein Name: Activin receptor type-2B

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B (431-466aa VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ACVR2B

Antigène: ACVR2B (Activin A Receptor, Type IIB (ACVR2B))

Autre désignation: ACVR2B (ACVR2B Produits)

Synonymes: anticorps ACVR2B, anticorps XAR1, anticorps actr-iib, anticorps actriib, anticorps ACTRIIB, anticorps ActR-IIB, anticorps HTX4, anticorps ActRIIB, anticorps actr2b, anticorps actrIIb, anticorps wu:fj97d11, anticorps activin A receptor type 2B, anticorps activin A receptor type 2B L homeolog, anticorps activin A receptor type 2Ba, anticorps activin receptor IIB, anticorps ACVR2B, anticorps acvr2b, anticorps acvr2b.L, anticorps Acvr2b, anticorps acvr2ba

Sujet: Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.

Synonyms: ActRIIB | ActR-IIB | ActR IIB | ACVR2B | ACVR-2B | ACVR 2B | HTX4 | MGC116908 | Q13705

ID gène: 93

UniProt: Q13705

Pathways: Hormone Transport, Cancer Immune Checkpoints