AGO2 anticorps (N-Term)

N° du produit ABIN4886438

Détail du produit anti-AGO2 anticorps

Antigène: AGO2 (Argonaute 2 (AGO2))

Épitope: AA 129-169, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGO2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Protein argonaute-2(AGO2) detection. Tested with WB in Human,Mouse,Rat.

Séquence: KVSIKWVSCV SLQALHDALS GRLPSVPFET IQALDVVMRH L

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Protein argonaute-2(AGO2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: argonaute 2, RISC catalytic component
Protein Name: Protein argonaute-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur AGO2

Antigène: AGO2 (Argonaute 2 (AGO2))

Autre désignation: AGO2 (AGO2 Produits)

Synonymes: anticorps EIF2C2, anticorps T19E23.7, anticorps T19E23_7, anticorps argonaute 2, anticorps Q10, anticorps Eif2c2, anticorps Argonaute2, anticorps eif2c1, anticorps eif2c2, anticorps 1110029L17Rik, anticorps 2310051F07Rik, anticorps AI225898, anticorps AL022874, anticorps AW546247, anticorps ENSMUSG00000072493, anticorps Gerp95, anticorps Gm10365, anticorps mKIAA4215, anticorps AGO2, anticorps AG02, anticorps AGO 2, anticorps Ago-2, anticorps Ago2, anticorps CG13452, anticorps CG7439, anticorps Dm Ago2, anticorps Dmel\\CG7439, anticorps ago, anticorps ago-2, anticorps ago2, anticorps dAGO2, anticorps dAgo2, anticorps eIF2C2, anticorps argonaute 2, RISC catalytic component, anticorps Argonaute family protein, anticorps argonaute 2, RISC catalytic component L homeolog, anticorps argonaute RISC catalytic subunit 2, anticorps argonaute RISC catalytic component 2, anticorps Argonaute 2, anticorps AGO2, anticorps Ago2, anticorps ago2.L, anticorps ago2

Sujet: Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: Ago 2 | Ago2 | Argonaute2 | Argonaute-2 | Argonaute 2 | dAgo2 | eIF 2C 2 | eIF-2C 2 | eIF2C 2 | Eif2c2 | hAgo2 | PAZ Piwi domain protein | PPD | Q10 | Slicer protein | Q9UKV8

ID gène: 27161

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Ribonucleoprotein Complex Subunit Organization