AP2M1 anticorps (C-Term)
-
- Antigène Voir toutes AP2M1 Anticorps
- AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))
-
Épitope
- AA 399-435, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AP2M1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- LKVRYLKVFE PKLNYSDHDV IKWVRYIGRS GIYETRC
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for AP-2 complex subunit mu(AP2M1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adaptor related protein complex 2 mu 1 subunit
Protein Name: AP-2 complex subunit mu - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product AP2M1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- AP2M1 (Adaptor-Related Protein Complex 2, mu 1 Subunit (AP2M1))
- Autre désignation
- AP2M1 (AP2M1 Produits)
- Synonymes
- anticorps AP50, anticorps CLAPM1, anticorps mu2, anticorps Ap50, anticorps Clapm1, anticorps cb34, anticorps Ap2m1, anticorps dpy-23, anticorps sb:cb34, anticorps zgc:55711, anticorps zgc:85653, anticorps wu:fa97a10, anticorps ap2m1-a, anticorps ap2m1, anticorps zgc:56643, anticorps AP2M1, anticorps adaptor related protein complex 2 mu 1 subunit, anticorps adaptor-related protein complex 2, mu 1 subunit, anticorps adaptor-related protein complex 2, mu 1 subunit, a, anticorps adaptor related protein complex 2 mu 1 subunit L homeolog, anticorps adaptor-related protein complex 2, mu 1 subunit, b, anticorps AP-2 complex subunit mu-1, anticorps clathrin coat assembly protein AP50, anticorps clathrin coat assembly protein ap50, anticorps AP2M1, anticorps Ap2m1, anticorps ap2m1a, anticorps ap2m1.L, anticorps ap2m1b, anticorps ap2m1, anticorps cgd8_950, anticorps PY06523, anticorps PVX_118455, anticorps PVX_123590, anticorps CpipJ_CPIJ003697
- Sujet
-
AP-2 complex subunit mu is a protein that in humans is encoded by the AP2M1 gene. This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene.
Synonyms: Adaptin mu 1 | Adaptin-mu2 | AP 2 mu 2 chain | AP-2 complex subunit mu | Ap2m1 | AP50 | CLAPM1 | Q96CW1 - ID gène
- 1173
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signaling Pathway, EGFR Downregulation, SARS-CoV-2 Protein Interactome
-