E2F4 anticorps (N-Term)

N° du produit ABIN4886566

Détail du produit anti-E2F4 anticorps

Antigène: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Épitope: AA 106-144, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp E2F4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Transcription factor E2F4(E2F4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ELQQREQELD QHKVWVQQSI RNVTEDVQNS CLAYVTHED

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Transcription factor E2F4(E2F4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: E2F transcription factor 4, p107/p130-binding
Protein Name: Transcription factor E2F4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur E2F4

Antigène: E2F4 (E2F Transcription Factor 4, P107/p130-Binding (E2F4))

Autre désignation: E2F4 (E2F4 Produits)

Synonymes: anticorps E2F-4, anticorps 2010111M04Rik, anticorps AI427446, anticorps E2F4, anticorps e2f-4, anticorps fb72f07, anticorps wu:fb72f07, anticorps wu:fe05f06, anticorps zgc:63815, anticorps E2F transcription factor 4, anticorps E2F transcription factor 4 S homeolog, anticorps E2F4, anticorps E2f4, anticorps e2f4.S, anticorps e2f4

Sujet: Transcription factor E2F4 is a protein that in humans is encoded by the E2F4 gene. The protein encoded by this gene is a member of the E2F family of transcription factors. This gene is mapped to 16q22.1. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. Additionally, it plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

Synonyms: E2F4 | E2F-4 | Transcription factor E2F4 | Q16254

ID gène: 1874

UniProt: Q16254

Pathways: Cycle Cellulaire, Mitotic G1-G1/S Phases, Regulation of Cell Size