PSMA1 anticorps (C-Term)
-
- Antigène Voir toutes PSMA1 Anticorps
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
-
Épitope
- AA 159-204, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMA1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-1(PSMA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- MSIGARSQSA RTYLERHMSE FMECNLNELV KHGLRALRET LP
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-1(PSMA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 1
Protein Name: Proteasome subunit alpha type-1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human PSMA1 (159-204aa MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PSMA1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
- Autre désignation
- PSMA1 (PSMA1 Produits)
- Synonymes
- anticorps PSMA1, anticorps pros30, anticorps DDBDRAFT_0204226, anticorps DDBDRAFT_0214956, anticorps DDB_0204226, anticorps DDB_0214956, anticorps C2, anticorps HC2, anticorps Pros-30, anticorps alpha-type, anticorps NU, anticorps PROS30, anticorps CC2, anticorps zgc:92726, anticorps 143314_at, anticorps Alpha-6, anticorps CG4904, anticorps Dmel\CG4904, anticorps PROS-35, anticorps PROS-Dm35, anticorps Pros-35, anticorps Pros-Dm35, anticorps Prosalpha6, anticorps alpha6, anticorps alpha_dm, anticorps anon-SAGE:Wang-116, anticorps pros 35, anticorps pros35, anticorps proteasome subunit alpha 1, anticorps proteasome subunit alpha type 1, anticorps 20S proteasome subunit C2, anticorps proteasome (prosome, macropain) subunit, alpha type 1, anticorps proteasome subunit alpha 1 L homeolog, anticorps Proteasome alpha6 subunit, anticorps PSMA1, anticorps psma1, anticorps CNB05540, anticorps psmA1, anticorps Psma1, anticorps psma1.L, anticorps Prosalpha6
- Sujet
-
Proteasome subunit alpha type-1 is a protein that in humans is encoded by the PSMA1 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Synonyms: HC 2 | HC2 | PROS30 | PROS-30 | PROS 30 | PSC 2 | PSC2 | PSMA 1 | PSMA1 | P25786 - ID gène
- 5682
- UniProt
- P25786
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-