PSMA3 anticorps (Middle Region)

N° du produit ABIN4886706

Détail du produit anti-PSMA3 anticorps

Antigène: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Épitope: AA 88-127, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-3(PSMA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: LADIAREEAS NFRSNFGYNI PLKHLADRVA MYVHAYTLYS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-3(PSMA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 3
Protein Name: Proteasome subunit alpha type-3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PSMA3

Antigène: PSMA3 (Proteasome Subunit Alpha Type 3 (PSMA3))

Autre désignation: PSMA3 (PSMA3 Produits)

Synonymes: anticorps HC8, anticorps PSC3, anticorps Psma3l, anticorps psma3, anticorps im:6909944, anticorps zgc:114044, anticorps Lmpc8, anticorps proteasome subunit alpha 3, anticorps proteasome subunit alpha 3 L homeolog, anticorps proteasome (prosome, macropain) subunit, alpha type 3, anticorps PSMA3, anticorps Psma3, anticorps psma3.L, anticorps psma3

Sujet: Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.

Synonyms: HC8 | Macropain subunit C8 | PSC8 | psmA3 | P25788

ID gène: 5684

UniProt: P25788

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA