SLC18A3 anticorps (N-Term)

N° du produit ABIN4886722

Détail du produit anti-SLC18A3 anticorps

Antigène: SLC18A3 (Solute Carrier Family 18 (Vesicular Acetylcholine), Member 3 (SLC18A3))

Épitope: AA 1-36, N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC18A3 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection. Tested with WB in Human,Mouse.

Séquence: MESAEPAGQA RAAATKLSEA VGAALQEPRR QRRLVL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection. Tested with WB in Human,Mouse.
Gene Name: solute carrier family 18 member A3
Protein Name: Vesicular acetylcholine transporter

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL), different from the related mouse and rat sequences by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SLC18A3

Antigène: SLC18A3 (Solute Carrier Family 18 (Vesicular Acetylcholine), Member 3 (SLC18A3))

Autre désignation: SLC18A3 (SLC18A3 Produits)

Synonymes: anticorps VACht, anticorps rVAT, anticorps Slc18a3, anticorps MGC64220, anticorps VACHT, anticorps VAChT, anticorps VAT, anticorps SLC18A3, anticorps CG12345, anticorps CG32848, anticorps CT41182, anticorps Dmel\\CG32848, anticorps Vacht, anticorps vAChT, anticorps vacht, anticorps VAChT-A, anticorps zgc:153442, anticorps solute carrier family 18 member A3, anticorps solute carrier family 18 (vesicular acetylcholine transporter), member 3b, anticorps solute carrier family 18 (vesicular monoamine), member 3, anticorps solute carrier family 18 (vesicular acetylcholine transporter), member 3, anticorps Vesicular acetylcholine transporter, anticorps solute carrier family 18 (vesicular acetylcholine transporter), member 3a, anticorps Slc18a3, anticorps slc18a3b, anticorps SLC18A3, anticorps slc18a3, anticorps VAChT, anticorps slc18a3a

Sujet: The Vesicular acetylcholine transporter (VAChT), also known as SLC18A3, is a neurotransmitter transporter which is responsible for loadingacetylcholine (ACh) into secretory organelles in neurons making acetylcholine available for secretion. It is encoded by Solute carrier family 18, member 3 (SLC18A3) gene. This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.

Synonyms: AChR | Rvat | Slc18a3 | VAChT | Q16572

ID gène: 6572

UniProt: Q16572