PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) anticorps

Détails pour le produit réf. ABIN4890003
Antigène
Reactivité
Humain
29
14
5
2
2
2
1
1
1
Hôte
Lapin
27
2
Clonalité
Polyclonal
Conjugué
Inconjugué
2
2
2
2
2
2
Application
Western Blotting (WB)
29
17
5
2
Options
Immunogène Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM.
Purification Immunogen affinity purified
Antigène
Autre désignation PWP2H
Sujet Gene Symbol: PWP2
ID gène 5822
UniProt Q15269
Indications d'application Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PWP2 and was validated on Western blot.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.
Images
Image no. 1 for anti-PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) antibody (ABIN4890003) Western Blot: PWP2H Antibody [NBP1-52844] - Reccomended Titration: 0.2 - 1 ug/ml ELIS...
Image no. 2 for anti-PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) antibody (ABIN4890003) Western Blot: PWP2H Antibody [NBP1-52844] - Analysis of 721_B cell lysate. Antibody D...
Image no. 3 for anti-PWP2 (Periodic Tryptophan Protein) Homolog, Yeast (PWP2H) antibody (ABIN4890003) Western Blot: PWP2H Antibody [NBP1-52844] - Sample Type: MCF7 Antibody Dilution: 1.0 ...