Malignant T Cell Amplified Sequence 1 (MCTS1) (N-Term) anticorps

Détails pour le produit réf. ABIN4891880, Fournisseur: Connectez-vous pour afficher
  • MCT-1
  • MCT1
  • 1500019M23Rik
  • zgc:56242
  • mcts1
  • MGC89874
  • MCTS1
  • MCT-1A
  • mct-1
  • mct1
  • MCTS1, re-initiation and release factor
  • malignant T cell amplified sequence 1
  • malignant T-cell amplified sequence 1
  • malignant T-cell amplified sequence 1 S homeolog
  • monocarboxylate transporter 1
  • MCTS1
  • Mcts1
  • mcts1
  • mcts1.S
  • MCT1
Humain, Souris
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène Synthetic peptides corresponding to MCTS1(malignant T cell amplified sequence 1) The peptide sequence was selected from the N terminal of MCTS1. Peptide sequence MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV.
Purification Immunogen affinity purified
Autre désignation MCTS1 (MCTS1 Antibody Extrait)
Sujet Gene Symbol: MCTS1
Poids moléculaire Theoretical MW: 20 kDa
ID gène 28985
UniProt Q9ULC4
Indications d'application Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against MCTS1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Agent conservateur Without preservative
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.
Images (Fournisseur)
Western Blotting (WB) image for anti-Malignant T Cell Amplified Sequence 1 (MCTS1) (N-Term) antibody (ABIN4891880) Western Blot: MCTS1 Antibody [NBP1-58236] - COLO205 cells lysate, concentration 0.2-1...
Produit citée dans: Haas, Ngo, Li, Schleich, Qu, Vanyai, Cullen, Cardona-Alberich, Gladwyn-Ng, Pagnamenta, Taylor, Stewart, Kini, Duncan, Teleman, Keays, Heng: "De Novo Mutations in DENR Disrupt Neuronal Development and Link Congenital Neurological Disorders to Faulty mRNA Translation Re-initiation." dans: Cell reports, Vol. 15, Issue 10, pp. 2251-65, 2016 (PubMed). (Échantillon (espèces): Mouse (Murine)). Détails: Western Blotting

Avez-vous cherché autre chose?