F-Box Protein 34 (FBXO34) (N-Term) anticorps

Détails pour le produit réf. ABIN4892917, Fournisseur: Connectez-vous pour afficher
  • Fbx34
  • 2900057B08Rik
  • 5830426G16Rik
  • FBXO34
  • F-box protein 34
  • F-box protein 34 L homeolog
  • FBXO34
  • Fbxo34
  • fbxo34.L
  • fbxo34
Souris, Rat (Rattus)
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène Synthetic peptides corresponding to Fbxo34 (F-box protein 34) The peptide sequence was selected from the N terminal of Fbxo34. Peptide sequence RDTLRTPMSHGKANGDVKARASYMKPTVLPSASLVKASSRKPFGILSPNV.
Purification Immunogen affinity purified
Autre désignation FBXO34 (FBXO34 Antibody Extrait)
Sujet Gene Symbol: FBXO34
Poids moléculaire Theoretical MW: 82 kDa
ID gène 55030
Indications d'application Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against Fbxo34 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.
Images (Fournisseur)
Western Blotting (WB) image for anti-F-Box Protein 34 (FBXO34) (N-Term) antibody (ABIN4892917) Western Blot: FBXO34 Antibody [NBP1-68997] - Rat Brain lysate, concentration 0.2-1 ug...