CYP20A1 anticorps (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1) (N-Term)

Details for Product anti-CYP20A1 Antibody No. ABIN4893239, Fournisseur: Connectez-vous pour afficher
Antigène
  • CYP-M
  • A930011N14Rik
  • Cypm
  • wu:fa10c06
  • zgc:63986
  • cyp-m
  • cytochrome P450 family 20 subfamily A member 1
  • cytochrome P450, family 20, subfamily a, polypeptide 1
  • cytochrome P450, family 20, subfamily A, polypeptide 1
  • cytochrome P450 family 20 subfamily A member 1 L homeolog
  • CYP20A1
  • Cyp20a1
  • cyp20a1
  • cyp20a1.L
Épitope
N-Term
6
4
4
4
3
3
2
2
2
2
1
1
1
Reactivité
Humain
70
21
21
2
2
2
2
2
1
1
1
1
Hôte
Lapin
50
20
Clonalité
Polyclonal
Conjugué
Cet anticorp CYP20A1 est non-conjugé
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
51
30
24
13
9
8
2
1
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène Synthetic peptides corresponding to CYP20A1(cytochrome P450, family 20, subfamily A, polypeptide 1) The peptide sequence was selected from the N terminal of CYP20A1. Peptide sequence ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV.
Purification Immunogen affinity purified
Autre désignation CYP20A1 (CYP20A1 Antibody Extrait)
Sujet Gene Symbol: CYP20A1
Poids moléculaire Theoretical MW: 52 kDa
ID gène 57404
UniProt Q6UW02
Indications d'application Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CYP20A1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.
Images (Fournisseur)
Western Blotting (WB) image for anti-Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1) (N-Term) antibody (ABIN4893239) Western Blot: CYP20A1 Antibody [NBP1-69680] - This Anti-CYP20A1 antibody was used in ...
Avez-vous cherché autre chose?