FBXL20 anticorps (F-Box and Leucine-Rich Repeat Protein 20) (N-Term)

Details for Product anti-FBXL20 Antibody No. ABIN4893647, Fournisseur: Connectez-vous pour afficher
Antigène
  • Fbl2
  • Fbl20
  • fbl20
  • MGC81000
  • scrapper
  • 2610511F20Rik
  • 4632423N09Rik
  • AI849362
  • AL117906
  • C86145
  • Scr
  • mKIAA4147
  • FBXL2
  • Fbxl2
  • F-box and leucine rich repeat protein 20
  • F-box and leucine-rich repeat protein 20 L homeolog
  • F-box and leucine-rich repeat protein 20
  • F-box/LRR-repeat protein 20
  • putative fbxl20
  • FBXL20
  • fbxl20.L
  • LOAG_14232
  • LOC100080065
  • Smp_097020.1
  • Fbxl20
Épitope
N-Term
11
7
4
2
2
1
1
1
1
Reactivité
Humain
32
17
16
5
5
4
4
4
2
2
2
2
Hôte
Lapin
27
3
2
Clonalité
Polyclonal
Conjugué
Cet anticorp FBXL20 est non-conjugé
1
1
1
Application
Western Blotting (WB)
26
22
16
5
3
2
2
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène Synthetic peptides corresponding to the N terminal of FBXL20. Immunizing peptide sequence RTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNM.
Purification Immunogen affinity purified
Plasmids, Primers & others Plasmids, Primers & others FBXL20 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation FBXL20 (FBXL20 Antibody Extrait)
Sujet Gene Symbol: FBXL20
Poids moléculaire Theoretical MW: 48 kDa
ID gène 84961
UniProt Q96IG2
Indications d'application Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against FBXL20 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.
Images (Fournisseur)
Western Blotting (WB) image for anti-F-Box and Leucine-Rich Repeat Protein 20 (FBXL20) (N-Term) antibody (ABIN4893647) Western Blot: FBXL20 Antibody [NBP1-74271] - Human Fetal Brain Lysate, concentration ...
Avez-vous cherché autre chose?