Crossover junction endonuclease EME1 (EME1) anticorps

N° du produit ABIN4950913

Détail du produit

Antigène: Crossover junction endonuclease EME1 (EME1)

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ of human EME1 were used as the immunogen for the EME1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the EME1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the EME1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détail du antigène

Antigène: Crossover junction endonuclease EME1 (EME1)

Autre désignation: EME1 (EME1 Produits)

Synonymes: anticorps 6820428D13, anticorps essential meiotic structure-specific endonuclease 1, anticorps Eme1

Sujet: Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.

UniProt: Q96AY2