Crossover junction endonuclease EME1 (EME1) anticorps

Détails pour le produit réf. ABIN4950913
Humain, Rat (Rattus)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Immunogène Amino acids DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ of human EME1 were used as the immunogen for the EME1 antibody.
Isotype IgG
Purification Antigen affinity
Autre désignation EME1 (EME1 Antibody Extrait)
Sujet Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.
UniProt Q96AY2
Indications d'application Optimal dilution of the EME1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the EME1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Crossover junction endonuclease EME1 (EME1) antibody (ABIN4950913) Western blot testing of human 1) HeLa, 2) Jurkat and 3) HUT lysate with EME1 antibody...
Image no. 2 for anti-Crossover junction endonuclease EME1 (EME1) antibody (ABIN4950913) IHC testing of FFPE rat intestine with EME1 antibody. HIER: Boil the paraffin section...