EPH Receptor B1 anticorps (EPHB1)

Details for Product anti-EPHB1 Antibody No. ABIN4950927
Antigène
  • ELK
  • EPHT2
  • Hek6
  • NET
  • ephb1-a
  • xek
  • Xek
  • MGC89790
  • EPHB1
  • CEK6
  • EK6
  • 9330129L11
  • AW488255
  • C130099E04Rik
  • Cek6
  • ENSMUSG00000074119
  • Elk
  • Elkh
  • Net
  • Ephb2
  • Erk
  • elk
  • EPH receptor B1
  • EPH receptor B1 S homeolog
  • ephrin type-B receptor 1
  • Eph receptor B1
  • EPHB1
  • ephb1.S
  • ephb1
  • LOC100467687
  • Ephb1
Reactivité
Humain
128
78
70
6
Hôte
Lapin
108
13
11
Clonalité
Polyclonal
Conjugué
Cet anticorp EPH Receptor B1 est non-conjugé
6
5
4
4
4
4
4
4
4
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
83
48
27
24
17
10
3
2
2
2
Options
Immunogène Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others EPH Receptor B1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation Eph Receptor B1 / EphB1 (EPHB1 Antibody Extrait)
Sujet Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.
UniProt P54762
Pathways Signalisation RTK
Indications d'application Optimal dilution of the EPHB1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the EPHB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-EPH Receptor B1 (EPHB1) antibody (ABIN4950927) Western blot testing of human 293 cell lysate with EPHB1 antibody. Expected/observed ...
Avez-vous cherché autre chose?