EPH Receptor B1 anticorps

N° du produit ABIN4950927

Détail du produit anti-EPH Receptor B1 anticorps

Antigène: EPH Receptor B1 (EPHB1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPH Receptor B1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the EPHB1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the EPHB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur EPH Receptor B1

Antigène: EPH Receptor B1 (EPHB1)

Autre désignation: Eph Receptor B1 / EphB1 (EPHB1 Produits)

Synonymes: anticorps ELK, anticorps EPHT2, anticorps Hek6, anticorps NET, anticorps ephb1-a, anticorps xek, anticorps Xek, anticorps MGC89790, anticorps EPHB1, anticorps CEK6, anticorps EK6, anticorps 9330129L11, anticorps AW488255, anticorps C130099E04Rik, anticorps Cek6, anticorps ENSMUSG00000074119, anticorps Elk, anticorps Elkh, anticorps Net, anticorps Ephb2, anticorps Erk, anticorps elk, anticorps EPH receptor B1, anticorps EPH receptor B1 S homeolog, anticorps ephrin type-B receptor 1, anticorps Eph receptor B1, anticorps EPHB1, anticorps ephb1.S, anticorps ephb1, anticorps LOC100467687, anticorps Ephb1

Sujet: Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

UniProt: P54762

Pathways: Signalisation RTK