FABP2 (Intestinal) anticorps

Détails pour le produit réf. ABIN4950974
Antigène
Reactivité
Humain, Souris, Rat (Rattus)
2
2
2
Hôte
Lapin
2
Clonalité
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
2
1
Options
Immunogène Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Sujet FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [UniProt]
UniProt P12104
Indications d'application Optimal dilution of the FABP2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (FFPE): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FABP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-FABP2 (Intestinal) antibody (ABIN4950974) Western blot testing of human SW620 cell lysate with FABP2 antibody. Expected/observe...
Image no. 2 for anti-FABP2 (Intestinal) antibody (ABIN4950974) IHC testing of FFPE mouse intestine with FABP2 antibody. HIER: Boil the paraffin sect...
Image no. 3 for anti-FABP2 (Intestinal) antibody (ABIN4950974) IHC testing of FFPE rat intestine with FABP2 antibody. HIER: Boil the paraffin sectio...
Avez-vous cherché autre chose?