FABP2 (Intestinal) anticorps

N° du produit ABIN4950974

Détail du produit

Antigène: FABP2 (Intestinal)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FABP2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (FFPE): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FABP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détail du antigène

Antigène: FABP2 (Intestinal)

Sujet: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [UniProt]

UniProt: P12104