FABP4 anticorps (Fatty Acid Binding Protein 4, Adipocyte)

Details for Product anti-FABP4 Antibody No. ABIN4950979
Antigène
  • A-FABP
  • AFABP
  • ALBP
  • aP2
  • LOC100223994
  • FABP
  • AP2
  • FABP3
  • FABP4
  • MGC84940
  • fabp4
  • 422/aP2
  • ALBP/Ap2
  • Ap2
  • Lbpl
  • Albp
  • fatty acid binding protein 4
  • fatty acid-binding protein, adipocyte
  • fatty acid binding protein 4, adipocyte
  • fatty acid binding protein 4, adipocyte L homeolog
  • Fatty acid-binding protein, adipocyte
  • adipocyte fatty acid-binding protein
  • adipocyte fatty acid binding protein
  • FABP4
  • LOC100223994
  • fabp4.L
  • fabp4
  • Fabp4
  • LOC100732353
  • LOC100861279
  • LOC100057425
  • LOC395224
Reactivité
Humain, Souris, Rat (Rattus)
238
113
84
10
3
3
3
3
3
3
2
2
2
1
1
Hôte
Lapin
202
51
10
6
2
1
Clonalité
Polyclonal
Conjugué
Cet anticorp FABP4 est non-conjugé
17
14
7
6
6
5
4
4
4
4
4
4
2
2
2
2
2
2
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
201
117
69
26
25
20
15
15
14
14
7
5
4
2
1
1
Options
Immunogène Amino acids KLVSSENFDDYMKEVGVGFATRKVAGMAKPN of human FABP4 were used as the immunogen for the FABP4 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others FABP4 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation FABP4 (FABP4 Antibody Extrait)
Sujet Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.
UniProt P15090
Pathways Brown Fat Cell Differentiation
Indications d'application Optimal dilution of the FABP4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FABP4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Fatty Acid Binding Protein 4, Adipocyte (FABP4) antibody (ABIN4950979) Western blot testing of 1) rat thymus, 2) rat heart, 3) mouse thymus and 4) mouse hea...
Image no. 2 for anti-Fatty Acid Binding Protein 4, Adipocyte (FABP4) antibody (ABIN4950979) IHC testing of FFPE rat intestine with FABP4 antibody. HIER: Boil the paraffin sectio...
Avez-vous cherché autre chose?