FABP4 anticorps

N° du produit ABIN4950979

Détail du produit anti-FABP4 anticorps

Antigène: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FABP4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids KLVSSENFDDYMKEVGVGFATRKVAGMAKPN of human FABP4 were used as the immunogen for the FABP4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FABP4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FABP4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur FABP4

Antigène: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Autre désignation: FABP4 (FABP4 Produits)

Synonymes: anticorps A-FABP, anticorps AFABP, anticorps ALBP, anticorps aP2, anticorps LOC100223994, anticorps FABP, anticorps AP2, anticorps FABP3, anticorps FABP4, anticorps MGC84940, anticorps fabp4, anticorps 422/aP2, anticorps ALBP/Ap2, anticorps Ap2, anticorps Lbpl, anticorps Albp, anticorps fatty acid binding protein 4, anticorps fatty acid-binding protein, adipocyte, anticorps fatty acid binding protein 4, adipocyte, anticorps fatty acid binding protein 4, adipocyte L homeolog, anticorps Fatty acid-binding protein, adipocyte, anticorps adipocyte fatty acid-binding protein, anticorps adipocyte fatty acid binding protein, anticorps FABP4, anticorps LOC100223994, anticorps fabp4.L, anticorps fabp4, anticorps Fabp4, anticorps LOC100732353, anticorps LOC100861279, anticorps LOC100057425, anticorps LOC395224

Sujet: Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

UniProt: P15090

Pathways: Brown Fat Cell Differentiation