FE65 anticorps

N° du produit ABIN4951012

Détail du produit anti-FE65 anticorps

Antigène: FE65 (APBB1) (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 (Fe65) (APBB1))

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FE65 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE of human FE65 were used as the immunogen for the FE65 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FE65 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FE65 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur FE65

Antigène: FE65 (APBB1) (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 (Fe65) (APBB1))

Autre désignation: FE65 (APBB1 Produits)

Synonymes: anticorps FE65, anticorps MGC:9072, anticorps RIR, anticorps apbb1, anticorps MGC80654, anticorps Fe65, anticorps Rir, anticorps amyloid beta precursor protein binding family B member 1, anticorps amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) L homeolog, anticorps amyloid beta (A4) precursor protein-binding, family B, member 1, anticorps APBB1, anticorps apbb1.L, anticorps Apbb1

Sujet: APBB1/RIR/FE65 is a transcription coregulator that can have both coactivator and corepressor functions. Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain. Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity. Function in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s). encoding different isoforms have been described for this gene.

UniProt: O00213

Pathways: Positive Regulation of Response to DNA Damage Stimulus