FMO1 anticorps (Flavin Containing Monooxygenase 1)

Details for Product anti-FMO1 Antibody No. ABIN4951057
Antigène
  • RFMO1A
  • flavin containing monooxygenase 1
  • FMO1
  • fmo1
  • Fmo1
Reactivité
Humain, Souris, Rat (Rattus)
18
5
3
2
2
2
2
2
1
Hôte
Lapin
16
2
Clonalité
Polyclonal
Application
Western Blotting (WB)
16
6
3
3
2
2
2
2
1
Options
Immunogène Amino acids AFPFLDESVVKVEDGQASLYKYIFPAHLQK of human FMO1 were used as the immunogen for the FMO1 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others FMO1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation FMO1 (FMO1 Antibody Extrait)
Sujet Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.
UniProt Q01740
Indications d'application Optimal dilution of the FMO1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Flavin Containing Monooxygenase 1 (FMO1) antibody (ABIN4951057) Western blot testing of 1) rat liver, 2) mouse liver, 3) rat kidney, 4) mouse kidney,...
Avez-vous cherché autre chose?