FMO2 anticorps

N° du produit ABIN4951058

Détail du produit anti-FMO2 anticorps

Antigène: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMO2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FMO2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FMO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur FMO2

Antigène: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Autre désignation: FMO2 (FMO2 Produits)

Synonymes: anticorps FMO 1B1, anticorps FMO 2, anticorps FMO1B1, anticorps 2310008D08Rik, anticorps 2310042I22Rik, anticorps AW107733, anticorps MGC68715, anticorps FMO4, anticorps FMO2, anticorps flavin containing monooxygenase 2, anticorps flavin containing monooxygenase 2 L homeolog, anticorps FMO2, anticorps Fmo2, anticorps fmo2.L

Sujet: Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2). It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.

UniProt: Q99518