FMO2 anticorps (Flavin Containing Monooxygenase 2 (Non-Functional))

Details for Product anti-FMO2 Antibody No. ABIN4951058
Antigène
  • FMO 1B1
  • FMO 2
  • FMO1B1
  • 2310008D08Rik
  • 2310042I22Rik
  • AW107733
  • MGC68715
  • FMO4
  • FMO2
  • flavin containing monooxygenase 2
  • flavin containing monooxygenase 2 L homeolog
  • FMO2
  • Fmo2
  • fmo2.L
Reactivité
Humain
26
11
10
2
2
2
1
1
Hôte
Lapin
29
Clonalité
Polyclonal
Application
Western Blotting (WB)
28
15
8
3
2
2
1
1
Options
Immunogène Amino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others FMO2 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation FMO2 (FMO2 Antibody Extrait)
Sujet Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2). It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.
UniProt Q99518
Indications d'application Optimal dilution of the FMO2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FMO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2) antibody (ABIN4951058) Western blot testing of human 1) A549, 2) HeLa, 3) MCF7, 4) SW620 cell lysate with FM...
Avez-vous cherché autre chose?