FMO3 anticorps

N° du produit ABIN4951059

Détail du produit anti-FMO3 anticorps

Antigène: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMO3 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids DMMNDINEKMEKKRKWFGKSETIQTDYIVY of human FMO3 were used as the immunogen for the FMO3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FMO3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FMO3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur FMO3

Antigène: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Autre désignation: FMO3 (FMO3 Produits)

Synonymes: anticorps MGC107820, anticorps FMOII, anticorps TMAU, anticorps dJ127D3.1, anticorps FM03, anticorps AW111792, anticorps flavin containing monooxygenase 3, anticorps flavin containing monooxygenase 3 L homeolog, anticorps FMO3, anticorps fmo3, anticorps fmo3.L, anticorps Fmo3

Sujet: FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.

UniProt: P31513