FMO3 anticorps (Flavin Containing Monooxygenase 3)

Details for Product anti-FMO3 Antibody No. ABIN4951059
Antigène
  • MGC107820
  • FMOII
  • TMAU
  • dJ127D3.1
  • FM03
  • AW111792
  • flavin containing monooxygenase 3
  • flavin containing monooxygenase 3 L homeolog
  • FMO3
  • fmo3
  • fmo3.L
  • Fmo3
Reactivité
Humain, Souris, Rat (Rattus)
88
42
38
5
5
5
4
4
3
2
2
1
1
Hôte
Lapin
84
5
Clonalité
Polyclonal
Conjugué
Cet anticorp FMO3 est non-conjugé
5
4
4
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
68
28
17
13
11
4
3
1
1
1
Options
Immunogène Amino acids DMMNDINEKMEKKRKWFGKSETIQTDYIVY of human FMO3 were used as the immunogen for the FMO3 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others FMO3 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation FMO3 (FMO3 Antibody Extrait)
Sujet FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.
UniProt P31513
Indications d'application Optimal dilution of the FMO3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FMO3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Flavin Containing Monooxygenase 3 (FMO3) antibody (ABIN4951059) Western blot testing of 1) rat liver, 2) mouse liver and 3) human SMMC lysate with FM...
Avez-vous cherché autre chose?