FMR1 anticorps (Fragile X Mental Retardation 1)

Details for Product anti-FMR1 Antibody No. ABIN4951062
Antigène
  • AT24755
  • BcDNA:GM08679
  • CG6203
  • Dmel\\CG6203
  • EP(3)3517
  • FMR
  • FMR1
  • FMRP
  • FMRp
  • FXR
  • Fmrp
  • cg6203
  • dFMR
  • dFMR1
  • dFMRP
  • dFXR
  • dFXR1
  • dFXRP
  • dFmr1
  • dFmrp
  • dfmr
  • dfmr1
  • dfxr
  • dfxr1
  • dmfr1
  • fmr
  • fmr1
  • FRAXA
  • POF
  • POF1
  • zFMR1
  • Fmr-1
  • CG6203 gene product from transcript CG6203-RC
  • fragile X mental retardation 1
  • fragile X mental retardation syndrome 1
  • Fmr1
  • FMR1
  • fmr1
Reactivité
Humain, Souris, Rat (Rattus)
157
83
81
9
8
4
4
3
3
2
2
1
1
1
Hôte
Lapin
105
44
14
Clonalité
Polyclonal
Conjugué
Cet anticorp FMR1 est non-conjugé
8
5
5
4
4
4
4
4
4
4
4
4
1
1
1
1
1
Application
Western Blotting (WB)
129
73
58
35
22
14
12
11
8
7
4
3
2
2
2
1
Options
Immunogène Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others FMR1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation FMRP / FMR1 (FMR1 Antibody Extrait)
Sujet FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
UniProt Q06787
Pathways Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
Indications d'application Optimal dilution of the FMRP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the FMRP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Fragile X Mental Retardation 1 (FMR1) antibody (ABIN4951062) Western blot testing of 1) rat testis, 2) mouse testis, 3) human HeLa and 4) human He...
Avez-vous cherché autre chose?