FMR1 anticorps

N° du produit ABIN4951062

Détail du produit anti-FMR1 anticorps

Antigène: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMR1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the FMRP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the FMRP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur FMR1

Antigène: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Autre désignation: FMRP / FMR1 (FMR1 Produits)

Synonymes: anticorps AT24755, anticorps BcDNA:GM08679, anticorps CG6203, anticorps Dmel\\CG6203, anticorps EP(3)3517, anticorps FMR, anticorps FMR1, anticorps FMRP, anticorps FMRp, anticorps FXR, anticorps Fmrp, anticorps cg6203, anticorps dFMR, anticorps dFMR1, anticorps dFMRP, anticorps dFXR, anticorps dFXR1, anticorps dFXRP, anticorps dFmr1, anticorps dFmrp, anticorps dfmr, anticorps dfmr1, anticorps dfxr, anticorps dfxr1, anticorps dmfr1, anticorps fmr, anticorps fmr1, anticorps FRAXA, anticorps POF, anticorps POF1, anticorps zFMR1, anticorps Fmr-1, anticorps CG6203 gene product from transcript CG6203-RC, anticorps fragile X mental retardation 1, anticorps fragile X mental retardation syndrome 1, anticorps Fmr1, anticorps FMR1, anticorps fmr1

Sujet: FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

UniProt: Q06787

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development