GADD45A anticorps (Growth Arrest and DNA-Damage-Inducible, alpha)

Details for Product anti-GADD45A Antibody No. ABIN4951127
Antigène
  • MGC53491
  • zgc:91795
  • gadd45a
  • GADD45A
  • ddit1
  • gadd45
  • GADD45
  • AA545191
  • Ddit1
  • DDIT1
  • Gadd45
  • growth arrest and DNA damage inducible alpha L homeolog
  • growth arrest and DNA-damage-inducible, alpha, b
  • growth arrest and DNA damage inducible alpha
  • growth arrest and DNA damage-inducible protein 45
  • growth arrest and DNA-damage-inducible 45 alpha
  • growth arrest and DNA-damage-inducible, alpha
  • gadd45a.L
  • gadd45ab
  • GADD45A
  • gadd45a
  • GADD45
  • Gadd45a
Reactivité
Humain
95
46
44
3
2
2
2
1
1
1
Hôte
Lapin
83
17
Clonalité
Polyclonal
Conjugué
Cet anticorp GADD45A est non-conjugé
4
3
3
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
71
29
17
13
8
6
6
5
5
5
2
2
1
1
Options
Immunogène Amino acids VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER were used as the immunogen for the GADD45A antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others GADD45A products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation GADD45A (GADD45A Antibody Extrait)
Sujet Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation.
UniProt P24522
Pathways Signalisation p53, Cycle Cellulaire
Indications d'application Optimal dilution of the GADD45A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GADD45A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A) antibody (ABIN4951127) Western blot testing of human MCF7 cell lysate with GADD45A antibody. Expected/observ...
Avez-vous cherché autre chose?