GAL4 anticorps

N° du produit ABIN4951128

Détail du produit anti-GAL4 anticorps

Antigène: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAL4 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GAL4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GAL4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GAL4

Antigène: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Autre désignation: GAL4 / Galectin-4 (LGALS4 Produits)

Synonymes: anticorps LGALS4, anticorps gal4, anticorps l36lbp, anticorps MGC86186, anticorps galectin-4, anticorps xgalectin-VIa, anticorps gal-4, anticorps L36LBP, anticorps L-36, anticorps L36LBI, anticorps GAL4, anticorps galectin 4, anticorps lectin, galactoside-binding, soluble, 4 L homeolog, anticorps Galectin-4, anticorps lectin, galactose binding, soluble 4, anticorps LGALS4, anticorps lgals4.L, anticorps leg4, anticorps Lgals4

Sujet: Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.

UniProt: P56470