Lectin, Galactoside-Binding, Soluble, 4 (LGALS4) anticorps

Détails pour le produit réf. ABIN4951128
Antigène
  • LGALS4
  • gal4
  • l36lbp
  • MGC86186
  • galectin-4
  • xgalectin-VIa
  • gal-4
  • L36LBP
  • L-36
  • L36LBI
  • GAL4
  • galectin 4
  • lectin, galactoside-binding, soluble, 4 L homeolog
  • Galectin-4
  • lectin, galactose binding, soluble 4
  • LGALS4
  • lgals4.L
  • leg4
  • Lgals4
Reactivité
Humain
77
12
11
5
3
3
3
2
1
1
1
1
1
1
Hôte
Lapin
79
16
2
Clonalité
Polyclonal
Conjugué
Inconjugué
8
7
4
3
3
2
1
1
1
1
1
1
1
Application
Western Blotting (WB)
82
46
41
26
14
12
12
11
6
3
2
1
1
Options
Immunogène Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation GAL4 / Galectin-4 (LGALS4 Antibody Extrait)
Sujet Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.
UniProt P56470
Indications d'application Optimal dilution of the GAL4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GAL4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Lectin, Galactoside-Binding, Soluble, 4 (LGALS4) antibody (ABIN4951128) Western blot testing of human 1) SW620 and 2) COLO320 cell lysate with GAL4 antibody....
Avez-vous cherché autre chose?