Lectin, Galactoside-Binding, Soluble, 9 (LGALS9) anticorps

Détails pour le produit réf. ABIN4951133
Antigène
  • huat
  • lgals9a
  • ecalectin
  • galectin-9
  • Lgals9
  • wu:fd20c09
  • zgc:111833
  • LGALS9
  • AA407335
  • AI194909
  • AI265545
  • LGALS35
  • Lgals5
  • gal-9
  • HUAT
  • LGALS9A
  • UAT
  • UATP.I
  • galectin 9 L homeolog
  • galectin 9
  • lectin, galactoside-binding, soluble, 9 (galectin 9)-like 3
  • lectin, galactose binding, soluble 9
  • lgals9.L
  • lgals9
  • lgals9l3
  • LGALS9
  • Lgals9
Reactivité
Humain, Rat (Rattus)
115
57
51
8
5
4
2
2
1
1
1
Hôte
Lapin
130
24
Clonalité
Polyclonal
Conjugué
Inconjugué
18
9
7
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
128
53
50
23
22
16
15
14
12
8
6
3
2
2
1
Options
Immunogène Amino acids DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT of human Galectin 9 were used as the immunogen for the Galectin 9 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Galectin 9 (LGALS9 Antibody Extrait)
Sujet Galectin-9 is a protein that in humans is encoded by the LGALS9 gene. It is mapped to 17q11.2. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and / or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.
UniProt O00182
Indications d'application Optimal dilution of the Galectin 9 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Galectin 9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Lectin, Galactoside-Binding, Soluble, 9 (LGALS9) antibody (ABIN4951133) Western blot testing of rat stomach lysate with Galectin 9 antibody. Expected/observe...
Avez-vous cherché autre chose?