GNAQ anticorps (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide)

Details for Product anti-GNAQ Antibody No. ABIN4951194
Antigène
  • si:ch73-270f14.2
  • CMC1
  • G-ALPHA-q
  • GAQ
  • SWS
  • Galphaq
  • Gnaq
  • g-alpha-q
  • gaq
  • gnaqb
  • 1110005L02Rik
  • 6230401I02Rik
  • AA408290
  • AW060788
  • Dsk1
  • Dsk10
  • Gq
  • GqI
  • guanine nucleotide binding protein (G protein), q polypeptide
  • G protein subunit alpha q
  • guanine nucleotide binding protein (G protein), q polypeptide S homeolog
  • guanine nucleotide binding protein, alpha q polypeptide
  • gnaq
  • GNAQ
  • Gnaq
  • gnaq.S
Reactivité
Humain, Souris, Rat (Rattus)
77
33
29
7
7
4
4
4
3
3
3
2
2
1
Hôte
Lapin
60
10
7
Clonalité
Polyclonal
Conjugué
Cet anticorp GNAQ est non-conjugé
5
5
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
58
36
13
12
5
3
2
2
1
Options
Immunogène Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND of human GNAQ were used as the immunogen for the GNAQ antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others GNAQ products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation GNAQ (GNAQ Antibody Extrait)
Sujet Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.
UniProt P50148
Pathways Signalistation JAK/STAT, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction
Indications d'application Optimal dilution of the GNAQ antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GNAQ antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) antibody (ABIN4951194) Western blot testing of 1) rat ovary, 2) rat testis, 3) mouse testis, 4) human 22RV1 ...
Image no. 2 for anti-Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) antibody (ABIN4951194) IHC testing of FFPE mouse testis tissue with GNAQ antibody. HIER: Boil the paraffin s...
Image no. 3 for anti-Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) antibody (ABIN4951194) IHC testing of FFPE rat ovary tissue with GNAQ antibody. HIER: Boil the paraffin sect...
Avez-vous cherché autre chose?