GNAQ anticorps

N° du produit ABIN4951194

Détail du produit anti-GNAQ anticorps

Antigène: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAQ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND of human GNAQ were used as the immunogen for the GNAQ antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GNAQ antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GNAQ antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GNAQ

Antigène: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Autre désignation: GNAQ (GNAQ Produits)

Synonymes: anticorps si:ch73-270f14.2, anticorps CMC1, anticorps G-ALPHA-q, anticorps GAQ, anticorps SWS, anticorps Galphaq, anticorps Gnaq, anticorps g-alpha-q, anticorps gaq, anticorps gnaqb, anticorps 1110005L02Rik, anticorps 6230401I02Rik, anticorps AA408290, anticorps AW060788, anticorps Dsk1, anticorps Dsk10, anticorps Gq, anticorps GqI, anticorps guanine nucleotide binding protein (G protein), q polypeptide, anticorps G protein subunit alpha q, anticorps guanine nucleotide binding protein (G protein), q polypeptide S homeolog, anticorps guanine nucleotide binding protein, alpha q polypeptide, anticorps gnaq, anticorps GNAQ, anticorps Gnaq, anticorps gnaq.S

Sujet: Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

UniProt: P50148

Pathways: Signalistation JAK/STAT, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction