GPX4 (Isoforms A/b/c) anticorps

Détails pour le produit réf. ABIN4951230
Antigène
Reactivité
Humain, Souris, Rat (Rattus)
Hôte
Lapin
Clonalité
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Options
Immunogène Amino acids ASRDDWRCARSMHEFSAKDIDGHMVNLDKYR of human GPX4 were used as the immunogen for the GPX4 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Sujet Glutathione peroxidase 4, also known as GPX4, is an enzyme that in humans is encoded by the GPX4 gene. This gene encodes a member of the glutathione peroxidase protein family. Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified. Alternative splicing results in multiple transcript variants.
UniProt P36969
Indications d'application Optimal dilution of the GPX4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GPX4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-GPX4 (Isoforms A/b/c) antibody (ABIN4951230) IHC testing of FFPE mouse testis with GPX4 antibody. HIER: Boil the paraffin sections...
Image no. 2 for anti-GPX4 (Isoforms A/b/c) antibody (ABIN4951230) Western blot testing of 1) rat testis and 2) mouse testis with GPX4 antibody. Expecte...
Image no. 3 for anti-GPX4 (Isoforms A/b/c) antibody (ABIN4951230) IHC testing of FFPE human testis with GPX4 antibody. HIER: Boil the paraffin sections...
Image no. 4 for anti-GPX4 (Isoforms A/b/c) antibody (ABIN4951230) IHC testing of FFPE rat testis with GPX4 antibody. HIER: Boil the paraffin sections i...
Avez-vous cherché autre chose?