GRK6 anticorps
-
- Antigène Voir toutes GRK6 Anticorps
- GRK6 (G Protein-Coupled Receptor Kinase 6 (GRK6))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GRK6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- Amino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product GRK6 Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the GRK6 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the GRK6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- GRK6 (G Protein-Coupled Receptor Kinase 6 (GRK6))
- Autre désignation
- GRK6 (GRK6 Produits)
- Synonymes
- anticorps MGC83187, anticorps GRK6, anticorps GPRK6, anticorps Gprk6, anticorps G protein-coupled receptor kinase 6, anticorps G protein-coupled receptor kinase 6 S homeolog, anticorps GRK6, anticorps grk6.S, anticorps grk6, anticorps Grk6
- Sujet
- G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses tomorphine.
- UniProt
- P43250
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Negative Regulation of Transporter Activity
-