G Protein-Coupled Receptor Kinase 6 (GRK6) anticorps

Détails pour le produit réf. ABIN4951250
Antigène
  • MGC83187
  • GRK6
  • GPRK6
  • Gprk6
  • G protein-coupled receptor kinase 6
  • G protein-coupled receptor kinase 6 S homeolog
  • GRK6
  • grk6.S
  • grk6
  • Grk6
Reactivité
Humain, Rat (Rattus)
89
43
37
2
2
2
2
1
1
Hôte
Lapin
72
17
Clonalité
Polyclonal
Conjugué
Inconjugué
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
82
51
30
20
9
6
4
2
1
1
1
Options
Immunogène Amino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation GRK6 (GRK6 Antibody Extrait)
Sujet G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses tomorphine.
UniProt P43250
Pathways Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Negative Regulation of Transporter Activity
Indications d'application Optimal dilution of the GRK6 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GRK6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-G Protein-Coupled Receptor Kinase 6 (GRK6) antibody (ABIN4951250) Western blot testing of 1) rat lung, human 2) HeLa, 3) K562 and 4) Jurkat lysate with...
Avez-vous cherché autre chose?