HSPA9 anticorps

N° du produit ABIN4951254

Détail du produit anti-HSPA9 anticorps

Antigène: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA9 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GRP75 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GRP75 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HSPA9

Antigène: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Autre désignation: GRP75 (HSPA9 Produits)

Synonymes: anticorps APG-2, anticorps HS24/P52, anticorps HSPH2, anticorps RY, anticorps hsp70, anticorps hsp70RY, anticorps CSA, anticorps GRP-75, anticorps GRP75, anticorps HSPA9B, anticorps MOT, anticorps MOT2, anticorps MTHSP75, anticorps PBP74, anticorps Hspa9a, anticorps csa, anticorps grp-75, anticorps grp75, anticorps hspa9, anticorps hspa9b, anticorps mortalin, anticorps mot, anticorps mot2, anticorps pbp74, anticorps mot-2, anticorps mthsp75, anticorps 74kDa, anticorps Csa, anticorps Grp75, anticorps Hsc74, anticorps Hsp74, anticorps Hsp74a, anticorps Mortalin, anticorps Mot-2, anticorps Mot2, anticorps Mthsp70, anticorps Pbp74, anticorps cb740, anticorps crs, anticorps wu:fc14d08, anticorps wu:fc27c10, anticorps wu:fc38a06, anticorps heat shock protein family A (Hsp70) member 4, anticorps heat shock protein family A (Hsp70) member 9, anticorps heat shock protein family A member 9, anticorps heat shock protein family A (Hsp70) member 9 S homeolog, anticorps stress-70 protein, mitochondrial, anticorps heat shock protein 9, anticorps heat shock protein Hsp9, anticorps HSPA4, anticorps HSPA9, anticorps Hspa9, anticorps hspa9.S, anticorps hspa9, anticorps LOC577721, anticorps hsp9

Sujet: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

UniProt: P38646