HSPA9 anticorps (Heat Shock 70kDa Protein 9 (Mortalin))

Details for Product anti-HSPA9 Antibody No. ABIN4951254
Antigène
  • csa
  • grp-75
  • grp75
  • hspa9
  • hspa9b
  • mortalin
  • mot
  • mot2
  • pbp74
  • mot-2
  • mthsp75
  • HSPA9B
  • CSA
  • GRP-75
  • GRP75
  • MOT
  • MOT2
  • MTHSP75
  • PBP74
  • 74kDa
  • Csa
  • Grp75
  • Hsc74
  • Hsp74
  • Hsp74a
  • Hspa9a
  • Mortalin
  • Mot-2
  • Mot2
  • Mthsp70
  • Pbp74
  • heat shock protein family A (Hsp70) member 9 S homeolog
  • heat shock protein family A (Hsp70) member 9
  • stress-70 protein, mitochondrial
  • heat shock protein 9
  • heat shock protein family A member 9
  • hspa9.S
  • hspa9
  • LOC577721
  • HSPA9
  • Hspa9
Reactivité
Humain, Souris, Rat (Rattus)
209
146
140
24
18
12
7
7
6
5
5
4
3
3
2
2
2
1
1
Hôte
Lapin
147
62
Clonalité
Polyclonal
Conjugué
Cet anticorp HSPA9 est non-conjugé
10
7
6
5
5
4
4
4
4
4
4
4
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
172
108
91
64
60
39
24
21
13
13
5
3
3
2
2
2
Options
Immunogène Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others HSPA9 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation GRP75 (HSPA9 Antibody Extrait)
Sujet HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.
UniProt P38646
Indications d'application Optimal dilution of the GRP75 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GRP75 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9) antibody (ABIN4951254) Western blot testing of 1) rat liver, 2) rat thymus, 3) rat testis, 4) mouse liver, 5...
Image no. 2 for anti-Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9) antibody (ABIN4951254) IHC testing of FFPE rat kidney with GRP75 antibody. HIER: Boil the paraffin sections ...
Image no. 3 for anti-Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9) antibody (ABIN4951254) IHC testing of FFPE mouse kidney with GRP75 antibody. HIER: Boil the paraffin section...
Avez-vous cherché autre chose?