GRP78 anticorps

N° du produit ABIN4951256

Détail du produit anti-GRP78 anticorps

Antigène: GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRP78 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the GRP78 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the GRP78 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur GRP78

Antigène: GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))

Autre désignation: GRP78 / BiP (HSPA5 Produits)

Synonymes: anticorps GRP78, anticorps BiP, anticorps GRP-78, anticorps grp78, anticorps hspa5a, anticorps BIP, anticorps MIF2, anticorps AL022860, anticorps AU019543, anticorps Bip, anticorps D2Wsu141e, anticorps D2Wsu17e, anticorps Grp78, anticorps Hsce70, anticorps SEZ-7, anticorps Sez7, anticorps baffled, anticorps mBiP, anticorps cb865, anticorps fb60h09, anticorps fi36d04, anticorps wu:fb60h09, anticorps wu:fi36d04, anticorps zgc:55994, anticorps zgc:77606, anticorps 78 kDa glucose-regulated protein, anticorps heat shock protein family A (Hsp70) member 5, anticorps BiP/GRP78, anticorps glucose-regulated protein 78, anticorps putative glucose-regulated protein 78, anticorps Hsp70 family ATPase KAR2, anticorps heat shock protein family A (Hsp70) member 5 S homeolog, anticorps heat shock 70 kDa protein 5a, anticorps heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa), anticorps heat shock protein 5, anticorps heat shock protein family A member 5, anticorps CpipJ_CPIJ003550, anticorps HSPA5, anticorps grp78, anticorps LOC100533358, anticorps BiP/grp78, anticorps Tc00.1047053506585.40, anticorps Tb11.02.5450, anticorps Tb11.02.5500, anticorps LMJF_28_1200, anticorps KAR2, anticorps LOC100135840, anticorps hspa5.S, anticorps hspa5, anticorps Hspa5

Sujet: HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

UniProt: P11021

Pathways: Thyroid Hormone Synthesis, ER-Nucleus Signaling