GRP78 anticorps (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa))

Details for Product anti-HSPA5 Antibody No. ABIN4951256
Antigène
  • GRP78
  • BiP
  • GRP-78
  • grp78
  • hspa5a
  • BIP
  • MIF2
  • AL022860
  • AU019543
  • Bip
  • D2Wsu141e
  • D2Wsu17e
  • Grp78
  • Hsce70
  • SEZ-7
  • Sez7
  • baffled
  • mBiP
  • cb865
  • fb60h09
  • fi36d04
  • wu:fb60h09
  • wu:fi36d04
  • zgc:55994
  • zgc:77606
  • 78 kDa glucose-regulated protein
  • heat shock protein family A (Hsp70) member 5
  • BiP/GRP78
  • glucose-regulated protein 78
  • putative glucose-regulated protein 78
  • Hsp70 family ATPase KAR2
  • heat shock protein family A (Hsp70) member 5 S homeolog
  • heat shock 70 kDa protein 5a
  • heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
  • heat shock protein 5
  • heat shock protein family A member 5
  • CpipJ_CPIJ003550
  • HSPA5
  • grp78
  • LOC100533358
  • BiP/grp78
  • Tc00.1047053506585.40
  • Tb11.02.5450
  • Tb11.02.5500
  • LMJF_28_1200
  • KAR2
  • LOC100135840
  • hspa5.S
  • hspa5
  • Hspa5
Reactivité
Humain, Souris, Rat (Rattus)
507
380
373
157
141
137
135
79
72
71
57
56
36
25
7
4
3
3
3
2
2
1
1
1
Hôte
Lapin
293
238
7
2
1
1
Clonalité
Polyclonal
Conjugué
Cet anticorp GRP78 est non-conjugé
33
22
21
18
17
16
13
12
12
12
12
12
12
12
12
12
12
7
7
7
7
7
7
6
6
6
6
6
6
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
489
267
216
202
180
103
56
45
28
13
13
11
10
3
3
2
Options
Immunogène Amino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others GRP78 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation GRP78 / BiP (HSPA5 Antibody Extrait)
Sujet HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.
UniProt P11021
Pathways Thyroid Hormone Synthesis, ER-Nucleus Signaling
Indications d'application Optimal dilution of the GRP78 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GRP78 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5) antibody (ABIN4951256) IHC testing of FFPE mouse testis with GRP78 antibody. HIER: Boil the paraffin section...
Image no. 2 for anti-Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5) antibody (ABIN4951256) Western blot testing of human HeLa cell lysate with GRP78 antibody. Predicted molecul...
Image no. 3 for anti-Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5) antibody (ABIN4951256) IHC testing of FFPE mouse brain with GRP78 antibody. HIER: Boil the paraffin sections...
Image no. 4 for anti-Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5) antibody (ABIN4951256) IHC testing of FFPE rat testis with GRP78 antibody. HIER: Boil the paraffin sections ...
Avez-vous cherché autre chose?