GSTA (Alpha 1-5) anticorps

Détails pour le produit réf. ABIN4951261
Antigène
Reactivité
Humain, Souris, Rat (Rattus)
1
1
1
Hôte
Lapin
1
Clonalité
Polyclonal
Application
Western Blotting (WB)
1
1
1
Options
Immunogène Amino acids MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE of human GSTA(1-5) were used as the immunogen for the GSTA antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Sujet Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules). In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.
UniProt P08263
Indications d'application Optimal dilution of the GSTA antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the GSTA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-GSTA (Alpha 1-5) antibody (ABIN4951261) Western blot testing of 1) rat liver and 2) mouse liver lysate with GSTA antibody. Pr...
Avez-vous cherché autre chose?