Histone Deacetylase 6 (HDAC6) anticorps

Détails pour le produit réf. ABIN4951283
Antigène
  • HD6
  • Hd6
  • Hdac5
  • Sfc6
  • mHDA2
  • CG6170
  • DHDAC2
  • DmHDAC2
  • Dmel\\CG6170
  • HDAC
  • HDAC2
  • dHDAC2
  • dHDAC6
  • dmHDA404
  • hdac6
  • MGC53140
  • wu:fc31d02
  • dsim_GLEANR_17355
  • DsimGD17207
  • GD17207
  • HDAC6
  • ATHDA6
  • AXE1
  • HISTONE DEACETYLASE 6
  • MDC12.7
  • MDC12_7
  • RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1
  • RPD3B
  • RTS1
  • SIL1
  • histone deacetylase 6
  • histone deacetylase 6
  • Histone deacetylase 6
  • histone deacetylase 6 L homeolog
  • GD17207 gene product from transcript GD17207-RB
  • Histone DeAcetylase
  • HDAC6
  • Hdac6
  • hdac6.L
  • hdac6
  • Dsim\HDAC6
  • PTRG_03035
  • HDA6
  • hda-6
Reactivité
Humain, Rat (Rattus)
262
138
68
20
6
6
3
3
3
3
1
1
Hôte
Lapin
235
38
1
Clonalité
Polyclonal
Conjugué
Inconjugué
11
6
5
5
5
5
5
5
4
3
3
3
2
2
2
2
2
Application
Western Blotting (WB)
208
141
96
77
44
26
25
17
17
14
8
6
2
1
1
1
Options
Immunogène Amino acids EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD of human HDAC6 were used as the immunogen for the HDAC6 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation HDAC6 (HDAC6 Antibody Extrait)
Sujet HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.
UniProt Q9UBN7
Pathways Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
Indications d'application Optimal dilution of the HDAC6 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HDAC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Histone Deacetylase 6 (HDAC6) antibody (ABIN4951283) Western blot testing of 1) rat skeletal muscle and 2) human COLO320 lysate with HDAC6...
Avez-vous cherché autre chose?