Heparanase (HPSE) anticorps

Détails pour le produit réf. ABIN4951290
Antigène
  • im:7144134
  • hpa
  • hpa1
  • hpr1
  • hpse1
  • hse1
  • HPSE
  • HPA
  • HPA1
  • HPR1
  • HPSE1
  • HSE1
  • Hpa
  • Hpr1
  • Hep
  • heparanase
  • HPSE
  • hpse
  • Hpse
Reactivité
Humain, Rat (Rattus)
161
87
58
3
3
3
2
2
1
Hôte
Lapin
172
19
Clonalité
Polyclonal
Conjugué
Inconjugué
20
9
5
4
4
4
4
4
4
2
2
2
2
2
2
2
2
2
2
Application
Western Blotting (WB)
141
55
54
26
20
16
15
12
5
4
4
2
1
Options
Immunogène Amino acids NGRTATKEDFLNPDVLDIFISSVQKVFQVVE of human Heparanase 1 were used as the immunogen for the Heparanase 1 antibody.
Isotype IgG
Purification Antigen affinity
Antigène
Autre désignation Heparanase 1 (HPSE Antibody Extrait)
Sujet Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.
UniProt Q9Y251
Pathways Glycosaminoglycan Metabolic Process
Indications d'application Optimal dilution of the Heparanase 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Heparanase (HPSE) antibody (ABIN4951290) Western blot testing of 1) rat liver, 2) human placenta, 3) A549 lysate with Heparana...
Avez-vous cherché autre chose?