HKDC1 anticorps

N° du produit ABIN4951305

Détail du produit anti-HKDC1 anticorps

Antigène: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HKDC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HKDC1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HKDC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HKDC1

Antigène: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Autre désignation: HKDC1 (HKDC1 Produits)

Synonymes: anticorps cb370, anticorps sb:cb370, anticorps HKDC1, anticorps BC016235, anticorps hexokinase domain containing 1, anticorps putative hexokinase HKDC1, anticorps hkdc1, anticorps HKDC1, anticorps LOC100088018, anticorps Hkdc1

Sujet: HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.

UniProt: Q2TB90