HKDC1 anticorps (Hexokinase Domain Containing 1)

Details for Product anti-HKDC1 Antibody No. ABIN4951305
Antigène
  • cb370
  • sb:cb370
  • HKDC1
  • BC016235
  • hexokinase domain containing 1
  • putative hexokinase HKDC1
  • hkdc1
  • HKDC1
  • LOC100088018
  • Hkdc1
Reactivité
Humain
39
9
8
2
1
1
1
1
1
1
Hôte
Lapin
33
6
Clonalité
Polyclonal
Conjugué
Cet anticorp HKDC1 est non-conjugé
4
3
3
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
30
24
2
1
1
1
Options
Immunogène Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others HKDC1 products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation HKDC1
Sujet HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.
UniProt Q2TB90
Indications d'application Optimal dilution of the HKDC1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the HKDC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Hexokinase Domain Containing 1 (HKDC1) antibody (ABIN4951305) Western blot testing of human 1) 293, 2) SW620, 3) COLO320 and 4) HeLa cell lysate wi...
Avez-vous cherché autre chose?